DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and SRP3

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_176586.1 Gene:SRP3 / 842706 AraportID:AT1G64030 Length:385 Species:Arabidopsis thaliana


Alignment Length:388 Identity:97/388 - (25%)
Similarity:165/388 - (42%) Gaps:69/388 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 VEKANKD--FMISPFSVWSLLVLLYEGSEGE-TRNQLKKSLRINVEDEKLRGAYKVWSSFL---N 149
            :..|.||  .:.||.|:.|.:.:...|..|: ...|:...||.:..|| |:..::..:|.:   .
plant    22 LSSAPKDSNVIFSPASINSAITMHAAGPGGDLVSGQILSFLRSSSIDE-LKTVFRELASVVYADR 85

  Fly   150 ITTSTIEVATLQAIYTGKGYPIKNNYRDAIQN-YNVQPMEVDFYSPDSVIQ------INEDTNRT 207
            ..|...::.....::..|..|....::|..:| :....:.|||.|....::      :...||..
plant    86 SATGGPKITAANGLWIDKSLPTDPKFKDLFENFFKAVYVPVDFRSEAEEVRKEVNSWVEHHTNNL 150

  Fly   208 TRGLIP---YTILPQDVYGAKMFLLSSLYFKGQWKFPFNKTLTREEPFFSESGEVIGKIPMMVQE 269
            .:.|:|   .|.|...:|.      ::|.|||.||.||.|..||:..|:..:|..: .:|.|...
plant   151 IKDLLPDGSVTSLTNKIYA------NALSFKGAWKRPFEKYYTRDNDFYLVNGTSV-SVPFMSSY 208

  Fly   270 ANFAYVSNVEGLDGY-VLELPY--GTQD---RLAMIVVLPKRGFKLNDVANNLKALGLRP--ILQ 326
            .|    ..|...||: ||.|||  |:.|   :.:|...||.:...|:|:   |:.:...|  :..
plant   209 EN----QYVRAYDGFKVLRLPYQRGSDDTNRKFSMYFYLPDKKDGLDDL---LEKMASTPGFLDS 266

  Fly   327 RLAAFRNRASEDNEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANLDRMSSGLFAKLVVHS 391
            .:..:|     |...:..:|||.....|::..||.::|:|.:                  .:.|.
plant   267 HIPTYR-----DELEKFRIPKFKIEFGFSVTSVLDRLGLRSM------------------SMYHK 308

  Fly   392 TKIIVDEQGTTAGAVTE----AALANKATPPK---FLLNRPFQYMIVEKATGLLLFAGQVRNP 447
            ..:.:||:|..|.|.|.    ....:...|||   |:.:.||.::|.|:.||.:||.||:.:|
plant   309 ACVEIDEEGAEAAAATADGDCGCSLDFVEPPKKIDFVADHPFLFLIREEKTGTVLFVGQIFDP 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 95/383 (25%)
SRP3NP_176586.1 serpinP_plants 8..371 CDD:381001 96/386 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.