DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and SERPIN1

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001320925.1 Gene:SERPIN1 / 841182 AraportID:AT1G47710 Length:418 Species:Arabidopsis thaliana


Alignment Length:481 Identity:116/481 - (24%)
Similarity:192/481 - (39%) Gaps:106/481 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CLMLWIPLLLGAIFLCSADPQNNQAPLQLSVGNPLTAFTAPTAFQSGVSHIQSMRSNFDTDVLVS 71
            |.:|.:.|.....|:..:.|.  |.|.::.|...:       :.|:.||      .|....|:.:
plant     2 CHLLRLALRRVRKFVYQSSPP--QPPAKMDVRESI-------SLQNQVS------MNLAKHVITT 51

  Fly    72 ISQGVQDFALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRINVEDEK 136
            :||                    |.:.:.||.|:..:|.::..||.|.|::|:...|:.:..|: 
plant    52 VSQ--------------------NSNVIFSPASINVVLSIIAAGSAGATKDQILSFLKFSSTDQ- 95

  Fly   137 LRGAYKVWSSFLNITTSTIEVATL--------------QAIYTGKGYPIKNNYRDAIQ-NYNVQP 186
                       ||..:|.|..|.|              ...:..|....|.:::..:: :|....
plant    96 -----------LNSFSSEIVSAVLADGSANGGPKLSVANGAWIDKSLSFKPSFKQLLEDSYKAAS 149

  Fly   187 MEVDFYSP--DSVIQINEDTNRTTRGLIPYTILPQDVYGA--KMFLLSSLYFKGQWKFPFNKTLT 247
            .:.||.|.  :.:.::|....:.|.|||. .:||:....:  |:...::|||||.|...|:::||
plant   150 NQADFQSKAVEVIAEVNSWAEKETNGLIT-EVLPEGSADSMTKLIFANALYFKGTWNEKFDESLT 213

  Fly   248 REEPFFSESGEVIGKIPMMVQEANFAYVSNVEGLDGYVLELPY--GTQDR-LAMIVVLPKRGFKL 309
            :|..|....|..: ..|.|..:.. .|||..:|..  ||.|||  |...| .:|...||.     
plant   214 QEGEFHLLDGNKV-TAPFMTSKKK-QYVSAYDGFK--VLGLPYLQGQDKRQFSMYFYLPD----- 269

  Fly   310 NDVANNLKALGLRPILQRLAAFRNRASEDNEV--------EVMMPKFVTATDFTLKGVLIQMGIR 366
               |||    ||..:|.::.:  .....||.:        |..:|||..:..|....||..:|:.
plant   270 ---ANN----GLSDLLDKIVS--TPGFLDNHIPRRQVKVREFKIPKFKFSFGFDASNVLKGLGLT 325

  Fly   367 DLF--DENTANL---DRMSSGLFAKLVVHSTKIIVDEQGT-----TAGAVTEAALANKATPPKFL 421
            ..|  :|....:   ..|...|....:.|...|.|:|:||     :||.:....|..:.....|:
plant   326 SPFSGEEGLTEMVESPEMGKNLCVSNIFHKACIEVNEEGTEAAAASAGVIKLRGLLMEEDEIDFV 390

  Fly   422 LNRPFQYMIVEKATGLLLFAGQVRNP 447
            .:.||..::.|..||::||.|||.:|
plant   391 ADHPFLLVVTENITGVVLFIGQVVDP 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 98/408 (24%)
SERPIN1NP_001320925.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.