DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and Serpina7

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_112390.1 Gene:Serpina7 / 81806 RGDID:619833 Length:426 Species:Rattus norvegicus


Alignment Length:385 Identity:113/385 - (29%)
Similarity:182/385 - (47%) Gaps:35/385 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 DFALDLLQRISVEVEKANKDFMI--SPFSVWSLLVLLYEGSEGETRNQLKKSLRINVED---EKL 137
            |||..|.:::|||    |.|..|  ||.|:.:.|.:|..||...|:.|:.:.|..|:.|   ::|
  Rat    59 DFAFRLYRKLSVE----NPDLNIFFSPVSISAALAMLSFGSGSSTQTQILEVLGFNLTDTPVKEL 119

  Fly   138 RGAYKVWSSFLNITTSTIEVATLQAIYTGKGY-PIKNNYRDAIQNYNVQPMEVDFYSPDSV-IQI 200
            :..::.....||...:.:|:....|::.|:.. |:.....|....|..:....||.:..:. .:|
  Rat   120 QQGFQHLICSLNFPNNELELQMGNAVFIGQQLKPLAKFLDDVKTLYETEVFSTDFSNVSAAQHEI 184

  Fly   201 NEDTNRTTRGLIPYTILPQDV-YGAKMFLLSSLYFKGQWKFPFNKTLTREEPFFSESGEVIGKIP 264
            |....:.|:|.|...|  ||: ....|.|::.::||.||..||..:.|.|...||.......::|
  Rat   185 NSYVEKQTKGKIVGLI--QDLKLNIIMILVNYIHFKAQWANPFRVSKTEESSNFSVDKSTTVQVP 247

  Fly   265 MMVQEANFAYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRG-FKLNDVANNLKALGLRPILQRL 328
            ||.|...:.:..:|| |:..||::.| :.:.||:. ||||.| .:..:.|.:.|.|         
  Rat   248 MMHQLEQYYHYVDVE-LNCTVLQMDY-SANALALF-VLPKEGHMEWVEAAMSSKTL--------- 300

  Fly   329 AAFRNRASEDNEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANLDRMS--SGLFAKLVVHS 391
             ...|...:...||:.:|||..:..:.|...|.:||:||.|.| :|:...::  :||......|.
  Rat   301 -KKWNHLLQKGWVELFVPKFSISATYDLGSTLQKMGMRDAFAE-SADFPGITKDNGLKLSYAFHK 363

  Fly   392 TKIIVDEQGTTAGAVTEA-ALANKATPP---KFLLNRPFQYMIVEKATGLLLFAGQVRNP 447
            ..:.:.|:||..||..|| :|......|   ...|:|.|..||:||.|..:||.|:|.:|
  Rat   364 AVLHIGEEGTKEGASPEAGSLDQPEVAPLHAVIRLDRTFLLMILEKRTRSVLFLGKVVDP 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 111/380 (29%)
Serpina7NP_112390.1 serpinA7_TBG 48..425 CDD:381023 113/385 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.