DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and AT2G26390

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_180207.1 Gene:AT2G26390 / 817179 AraportID:AT2G26390 Length:389 Species:Arabidopsis thaliana


Alignment Length:397 Identity:103/397 - (25%)
Similarity:175/397 - (44%) Gaps:70/397 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 VEVEKAN-KDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRINVEDEKLRGAYKVWSSFLNITT 152
            :|.:.|| .:.:.||.|:..||.|:..||...|:.::...|.....|.            ||...
plant    22 IETDVANGSNVVFSPMSINVLLSLIAAGSNPVTKEEILSFLMSPSTDH------------LNAVL 74

  Fly   153 STIE----------VATLQAIYTGKGYPIKNNYRDAIQN-YNVQPMEVDFYS-PDSVI-QINEDT 204
            :.|.          ::|...::..|...:|.::::.::| |.....:|||.: |..|| ::|...
plant    75 AKIADGGTERSDLCLSTAHGVWIDKSSYLKPSFKELLENSYKASCSQVDFATKPVEVIDEVNIWA 139

  Fly   205 NRTTRGLIPYTILPQD-------VYGAKMFLLSSLYFKGQWKFPFNKTLTREEPFFSESGEVIGK 262
            :..|.|||. .||.:|       :..:.:.|.:::|||..|...|:..||::..|....|..: |
plant   140 DVHTNGLIK-QILSRDCTDTIKEIRNSTLILANAVYFKAAWSRKFDAKLTKDNDFHLLDGNTV-K 202

  Fly   263 IPMMVQEANFAYVSNVEGLDGY-VLELPYGTQDR-LAMIVVLPKRGFKLNDVANNLKALGLRPIL 325
            :|.|:...:    ..:.|.||: ||.|||....| .:|.:.||      ||..      ||..:|
plant   203 VPFMMSYKD----QYLRGYDGFQVLRLPYVEDKRHFSMYIYLP------NDKD------GLAALL 251

  Fly   326 QRLAAFRNRASEDNEV--------EVMMPKFVTATDFTLKGVLIQMGIRDLFDEN---TANLDRM 379
            ::::.  .....|:.:        .:.:||...:.:|....||..||:...|...   |..:|..
plant   252 EKIST--EPGFLDSHIPLHRTPVDALRIPKLNFSFEFKASEVLKDMGLTSPFTSKGNLTEMVDSP 314

  Fly   380 SSG--LFAKLVVHSTKIIVDEQGTTAGAVTEAALANKA--TPPKFLLNRPFQYMIVEKATGLLLF 440
            |:|  |....::|...|.|||:||.|.||:.|.:..:.  ..|.|:.:.||.:.:.|..:|::||
plant   315 SNGDKLHVSSIIHKACIEVDEEGTEAAAVSVAIMMPQCLMRNPDFVADHPFLFTVREDNSGVILF 379

  Fly   441 AGQVRNP 447
            .|||.:|
plant   380 IGQVLDP 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 100/392 (26%)
AT2G26390NP_180207.1 serpinP_plants 8..386 CDD:381001 102/395 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.