DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and Serpind1

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_077358.1 Gene:Serpind1 / 79224 RGDID:619854 Length:479 Species:Rattus norvegicus


Alignment Length:453 Identity:120/453 - (26%)
Similarity:205/453 - (45%) Gaps:84/453 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SADPQNNQAPLQLSVGNPLTAFTAPTAFQSGVSHIQSMRSNFDTDVLVSISQGVQDFALDLLQRI 87
            :..|.::::    |.||.|..|       .|.|.||.:      ::|.:      .||.: |.|:
  Rat    80 AVSPTDSES----SAGNILQLF-------QGKSRIQRL------NILNA------KFAFN-LYRV 120

  Fly    88 SVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRINVEDEKLRGAYKVWSSFLNITT 152
            ..:...::.:..|:|..:.:.:.::..|..|||..::...|.              :..|:| .:
  Rat   121 LKDQATSSDNIFIAPVGISTAMGMISLGLRGETHEEVHSVLH--------------FKDFVN-AS 170

  Fly   153 STIEVA--------------------TLQAI---YTGKGYPIKNNYRDAIQN-YNVQPMEVDFYS 193
            |..||.                    |||::   |..|.:||:.:::.|::. |..:..|.||..
  Rat   171 SKYEVTTIHNLFRKLTHRLFRRNFGYTLQSVNDLYIQKQFPIREDFKAAMREFYFAEAQEADFSD 235

  Fly   194 PDSVIQINEDTNRTTRGLIPYTILPQDVYGAKMFLLSSLYFKGQWKFPFNKTLTREEPFFSESGE 258
            |..:.:.|....:.|:|||...:...| ...:|.:|:.:||||.|...|...:|....|.....|
  Rat   236 PAFISKANSHILKLTKGLIKEALENTD-SATQMMILNCIYFKGAWMNKFPVEMTHNHNFRLNERE 299

  Fly   259 VIGKIPMMVQEANFAYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKR--GFKLNDVANNLKALGL 321
            |: |:.||..:.|| ..:|.:.||..:|:|.|  ...::|::|:|::  |.|      .|:|...
  Rat   300 VV-KVSMMQTKGNF-LAANDQELDCDILQLEY--VGGISMLIVIPRKLSGMK------TLEAQLT 354

  Fly   322 RPILQR-LAAFRNRASEDNEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANLDRMS-SGLF 384
            ..:::| ..:..||..     ||::|||....::.|..||..|||..||::| .|:..:| ..:.
  Rat   355 PQVVERWQKSMTNRTR-----EVLLPKFKLEKNYNLVEVLKSMGITKLFNKN-GNMSGISDQRII 413

  Fly   385 AKLVVHSTKIIVDEQGTTAGAVTEAALANKATPPKFLLNRPFQYMIVEKATGLLLFAGQVRNP 447
            ..|..|.:.|.|:|:||.|.|||.......:|..:|.::|||.:::.|..|..|||.|:|.||
  Rat   414 IDLFKHQSTITVNEEGTQAAAVTTVGFMPLSTQVRFTVDRPFLFLVYEHRTSCLLFMGRVANP 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 106/396 (27%)
Serpind1NP_077358.1 HCII 44..477 CDD:239002 120/453 (26%)
2 X 11 AA approximate repeats, Asp/Glu-rich (acidic) (hirudin-like) 55..79
Glycosaminoglycan-binding site. /evidence=ECO:0000250 172..192 2/19 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.