DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and Serpina9

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001348839.1 Gene:Serpina9 / 71907 MGIID:1919157 Length:418 Species:Mus musculus


Alignment Length:426 Identity:112/426 - (26%)
Similarity:198/426 - (46%) Gaps:39/426 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LTAFTAP-------TAFQSGVSHIQSMRSNFDTDVLVSISQGVQDFALDLLQRISVEVEKANKDF 98
            |..|.||       ..:....||:.||:.|..:.|..|.::    |:..|.||::  .|...::.
Mouse    12 LVGFCAPIFCMLSSNPYNQESSHLPSMKKNPASQVSPSNTR----FSFLLYQRLA--QENPGQNI 70

  Fly    99 MISPFSVWSLLVLLYEGSEGETRNQLKKSLRIN---VEDEKLRGAYKVWSSFLNITTSTIEVATL 160
            :.||.|:.:.|.:|..|:...|:.|:.::|..|   |.:..:...::.....||......|:...
Mouse    71 LFSPVSISTSLAMLSLGARSATKTQILRTLGFNFTWVSEPTIHMGFEYLVRSLNKCHQGRELRMG 135

  Fly   161 QAIYTGKGYPIKNNYRDAIQN-YNVQPMEVDFYSPDSV-IQINEDTNRTTRGLIPYTILPQDVYG 223
            ..::..|...::..:.|.::. |..:....||.:..:. .|||....:.|:|.:...|...|...
Mouse   136 SVLFIRKELQLQATFLDRVKKLYGAKVFSEDFSNAATAQAQINSYVEKETKGKVVDVIQDLDSQT 200

  Fly   224 AKMFLLSSLYFKGQWKFPFNKTLTREE-PFFSESGEVIGKIPMMVQEANFAYVSNVEGLDGYVLE 287
            | |.|::.::||..|..||:...|.:. ||....|..: .:|||.|..:||:..:.| |...:|:
Mouse   201 A-MVLVNHIFFKANWTQPFSTANTNKSFPFLLSKGTTV-HVPMMHQTESFAFGVDKE-LGCSILQ 262

  Fly   288 LPYGTQDRLAMIVVLPKRGFKLNDVANNLKALGLRPILQRLAAFRNRASEDNEVEVMMPKFVTAT 352
            :.| ..|.:|.. |||.:| |:..:..:|.|..||.        .:|:.:...::|.:|||..:.
Mouse   263 MDY-RGDAVAFF-VLPGKG-KMRQLEKSLSARRLRK--------WSRSLQKRWIKVFIPKFSISA 316

  Fly   353 DFTLKGVLIQMGIRDLFDENTANLDRMSSGLFAKL--VVHSTKIIVDEQGTTAGAVTEAAL--AN 413
            .:.|:.:|.:|||||.|:.| |:...::...|.::  ..|...:.|.|:||.|.|.|...|  .:
Mouse   317 SYNLETILPKMGIRDAFNSN-ADFSGITKTHFLQVSKAAHKAVLDVSEEGTEAAAATTTKLIVRS 380

  Fly   414 KATPPKFL-LNRPFQYMIVEKATGLLLFAGQVRNPK 448
            :.||...: ...||..::::|.|..:||.|:|.||:
Mouse   381 RDTPSSIIAFKEPFLILLLDKNTESVLFLGKVENPR 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 98/379 (26%)
Serpina9NP_001348839.1 alpha-1-antitrypsin_like 49..412 CDD:239011 99/383 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.