DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and Serpinb12

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001186142.1 Gene:Serpinb12 / 71869 MGIID:1919119 Length:423 Species:Mus musculus


Alignment Length:436 Identity:108/436 - (24%)
Similarity:191/436 - (43%) Gaps:74/436 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 SISQGVQDFALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRIN---- 131
            |::.....|..|..:.||  .:.|:|:..:.|.|:.:...::..|:.|::.:|:.::|..|    
Mouse     3 SLTAANNKFCFDFFREIS--KDDAHKNIFVCPLSLSAAFGMVRLGARGDSAHQIDEALHFNELSK 65

  Fly   132 --------------------------------------VEDEKLRGAY--KVWSSFLNITTSTIE 156
                                                  ..|.:|.|.:  |:.|. ::...|...
Mouse    66 DEHKEPNDPSPQSESKASDSSLEGQKQTSASQDQQGESTNDHQLLGCHFGKLLSR-IDRDKSYYT 129

  Fly   157 VATLQAIYTGKGYPIKNNYRDAIQNYNVQPME-VDFY--SPDSVIQINEDTNRTTRGLIPYTILP 218
            ::....:|..:.:||.:.|.|.:..:....:| |||.  |..|..:||......::|.|      
Mouse   130 LSMANRLYGEQEFPICSEYSDDVTEFFHTTVESVDFQKDSEKSRQEINFWVESQSQGKI------ 188

  Fly   219 QDVYGAK-------MFLLSSLYFKGQWKFPFNKTLTREEPFFSESGEVIGKIPMMVQEANFAYVS 276
            ::::|.:       :.|::::|||.:|:..||...|.:..|.....|. ..:.||.|:..|. :.
Mouse   189 KELFGKEAIDNSTVLVLVNAVYFKAKWEREFNSENTVDASFCLNENEK-KTVKMMNQKGKFR-IG 251

  Fly   277 NVEGLDGYVLELPYGTQDRLAMIVVLPKRGFKLNDVANNLKALGLRPILQRLAAFRNRAS-EDNE 340
            .::.|...:||:.| ...:|:|:|:||...   .|..|:|:.|..:...::|.|:.:..: .:..
Mouse   252 FIDELQAQILEMKY-AMGKLSMLVLLPSCS---EDNVNSLQELEKKINHEKLLAWSSSENLSEKP 312

  Fly   341 VEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANLDRMSS--GLFAKLVVHSTKIIVDEQGTTA 403
            |.:..|:|.....:.||.:|..|||:|:|||..|:|..:|.  .|:...:||.|.:.|||.||.|
Mouse   313 VAISFPQFNLEDSYDLKSILQDMGIKDVFDETKADLTGISKSPNLYLSKIVHKTFVEVDEMGTQA 377

  Fly   404 GAVTEAALANKATPP--KFLLNRPFQYMIVEKATGLLLFAGQVRNP 447
            .|.:....|.||.|.  :|..|.||.:.|....|..|||.|:|..|
Mouse   378 AAASGVVAAEKALPSWVEFNANHPFLFFIRHNPTQSLLFCGRVYCP 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 105/427 (25%)
Serpinb12NP_001186142.1 SERPIN 4..423 CDD:294093 106/433 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..106 0/42 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.