DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and SERPINA7

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_006724746.1 Gene:SERPINA7 / 6906 HGNCID:11583 Length:425 Species:Homo sapiens


Alignment Length:423 Identity:109/423 - (25%)
Similarity:193/423 - (45%) Gaps:53/423 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 IQSMRSNFDTDVLVSISQGVQDFALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETR 121
            :.:..|:.....|..:|....|||.:|.:|.:||.  .:|:...||.|:.:.||:|..|:...|:
Human    27 VTACHSSQPNATLYKMSSINADFAFNLYRRFTVET--PDKNIFFSPVSISAALVMLSFGACCSTQ 89

  Fly   122 NQLKKSLRINVEDE---KLRGAYKVWSSFLNITTSTIEVATLQAIYTGKGY-PIKNNYRDAIQNY 182
            .::.::|..|:.|.   :::..::.....||.....:|:....|::.||.. |:.....|....|
Human    90 TEIVETLGFNLTDTPMVEIQHGFQHLICSLNFPKKELELQIGNALFIGKHLKPLAKFLNDVKTLY 154

  Fly   183 NVQPMEVDFYSPDSVIQ-INEDTNRTTRG--------LIPYTILPQDVYGAKMFLLSSLYFKGQW 238
            ..:....||.:..:..| ||......|:|        |.|.||         |.|::.::||.||
Human   155 ETEVFSTDFSNISAAKQEINSHVEMQTKGKVVGLIQDLKPNTI---------MVLVNYIHFKAQW 210

  Fly   239 KFPFNKTLTREEPFFSESGEVIGKIPMMVQEANFAYVSNVEGLDGYVLELPYGTQDRLAMIVVLP 303
            ..||:.:.|.:...|........::|||.|...:.::.::| |:..||::.| :::.||:. |||
Human   211 ANPFDPSKTEDSSSFLIDKTTTVQVPMMHQMEQYYHLVDME-LNCTVLQMDY-SKNALALF-VLP 272

  Fly   304 KRGFKLNDVANNLKALGLRPILQRLAAFRNRASEDNEVEVMMPKFVTATDFTLKGVLIQMGIRDL 368
            |.| ::..|...:.:..|:.        .||..:...|::.:|||..:..:.|...|::|||:..
Human   273 KEG-QMESVEAAMSSKTLKK--------WNRLLQKGWVDLFVPKFSISATYDLGATLLKMGIQHA 328

  Fly   369 FDENTANLDRMSSGLFAKL------------VVHSTKIIVDEQGTTAGAVTEAALA----NKATP 417
            :.|| |:...::.....||            ..|...:.:.|:||.|.||.|..|:    |....
Human   329 YSEN-ADFSGLTEDNGLKLSNRPAGFVLPTQAAHKAVLHIGEKGTEAAAVPEVELSDQPENTFLH 392

  Fly   418 PKFLLNRPFQYMIVEKATGLLLFAGQVRNPKAA 450
            |...::|.|..:|:|::|..:||.|:|.||..|
Human   393 PIIQIDRSFMLLILERSTRSILFLGKVVNPTEA 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 102/397 (26%)
SERPINA7XP_006724746.1 alpha-1-antitrypsin_like 46..419 CDD:239011 102/396 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.