DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and Serpina12

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_080811.1 Gene:Serpina12 / 68054 MGIID:1915304 Length:413 Species:Mus musculus


Alignment Length:430 Identity:108/430 - (25%)
Similarity:193/430 - (44%) Gaps:50/430 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LSVGNPLTAFTAPTAFQSGVSHIQSMRSNFDTDVLVSISQGVQDFALDLLQRISVEVEKANKDFM 99
            |:|...|....||..:.|.| .:|..|...|..   .:::...:|...||||::....:.|  ..
Mouse    15 LTVKGLLQDRDAPDMYDSPV-RVQEWRGKKDAR---QLARHNMEFGFKLLQRLASNSPQGN--IF 73

  Fly   100 ISPFSVWSLLVLLYEGSEGETRNQLKKSLRI-NVEDEKLRGAYKVWSSFLNITTSTIEVATLQAI 163
            :||.|:.:...:|..|::..|..::::.... .:.:..:..|:......||..|...::....|:
Mouse    74 LSPLSISTAFSMLSLGAQNSTLEEIREGFNFKEMSNWDVHAAFHYLLHKLNQETEDTKMNLGNAL 138

  Fly   164 YTGKGYPIKNNYRDAIQNYNVQPMEVDFYSPDSVIQINEDTNRTTRGLIPYTILPQDVY------ 222
            :..:....:..:.:..:|         .|..|.|:...:|...|.:.:..|  :.|..:      
Mouse   139 FMDQKLRPQQRFLNLAKN---------VYDADMVLTNFQDLENTQKDINRY--ISQKTHSRIKNM 192

  Fly   223 ------GAKMFLLSSLYFKGQWKFPFNKTLTREEPFFSESGEVIGKIPMMVQEA--NFAYVSNVE 279
                  |..|.|.:.:||:|:|::.|:...|:||.||.|.|:.: |:|||.|..  :.||.|.  
Mouse   193 VKSIDPGTVMILTNYIYFRGRWQYEFDPKQTKEEEFFIEKGKTV-KVPMMFQRGLYDMAYDSQ-- 254

  Fly   280 GLDGYVLELPYGTQDRLAMIVVLPKRGFKLNDVANNLKALGLRPILQRLAAFRNRASEDNEVEVM 344
             |...:||:||  :..:....|||..| ||..:...|:|       ...|.:::..|: ..|:|.
Mouse   255 -LSCTILEIPY--RGNITATFVLPDNG-KLKLLEQGLQA-------DIFAKWKSLLSK-RVVDVW 307

  Fly   345 MPKFVTATDFTLKGVLIQMGIRDLFDENTANLDRMSSGLFAKL--VVHSTKIIVDEQGTTAGAVT 407
            :||...::.:.:|.||.::||..:|:|| .:|.|:||....|:  .||..::.:||:|....|.:
Mouse   308 VPKLRISSTYNMKKVLSRLGISKIFEEN-GDLTRISSHRSLKVGEAVHKAELKMDEKGMEGAAGS 371

  Fly   408 EAALANKATPPKFLLNRPFQYMIVEKATGLLLFAGQVRNP 447
            .|......||....|:|||..||.|.....::|..::.:|
Mouse   372 GAQTLPMETPRHMKLDRPFLMMIYENFMPSMVFLARIYDP 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 97/385 (25%)
Serpina12NP_080811.1 alpha-1-antitrypsin_like 51..408 CDD:239011 97/385 (25%)
Reactive center loop. /evidence=ECO:0000250|UniProtKB:Q8IW75 364..382 4/17 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.