DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and Serpinb11

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_080143.1 Gene:Serpinb11 / 66957 MGIID:1914207 Length:388 Species:Mus musculus


Alignment Length:408 Identity:111/408 - (27%)
Similarity:192/408 - (47%) Gaps:55/408 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 ISQGVQDFALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRIN----V 132
            |:....:|.||:.:.:|  .....::...||.:.:..|.:|..|:.|::..|::|.|..:    |
Mouse     4 ITTASTEFCLDVFKELS--SNNVGENIFFSPLTTFYALSMLLLGTRGKSAEQMEKVLHYDSFSGV 66

  Fly   133 EDEKLRGA------------YKVWSSFLNITTSTIEVATLQAIYTGKGYPIKNNY-RDAIQNYNV 184
            ...|.:.:            ::...|.:|...|   ::....||..:.......| |...:.|..
Mouse    67 LKAKTKNSSECSQVGVMHPDFRALISHINQQNS---LSVANRIYGTRSISFHKQYVRCCEKLYQA 128

  Fly   185 QPMEVDF--YSPDSVIQINEDTNRTTRGLIPY-----TILPQDVYGAKMFLLSSLYFKGQWKFPF 242
            :...|||  .:.::...||......|.|.|..     ||.|..|    |.|:|::||||||:..|
Mouse   129 KLQTVDFELSTEETRKSINAWVKNKTNGKITNLFAKGTIDPSSV----MVLVSAIYFKGQWQNKF 189

  Fly   243 NKTLTREEPFFSESGEVIGK---IPMMVQEANFAYVSNVEGLDGYVLELPYGTQDRLAMIVVLPK 304
            .|..|.:.||...    :||   :.||.|...|. ::.::..:..|||||| ..::|.||::||.
Mouse   190 QKRETVKAPFHMG----VGKSAVVNMMYQTGTFK-LAIIKEPEMQVLELPY-ANNKLRMIILLPV 248

  Fly   305 RGFKLNDVANNLKALGLRPILQRLAAFRNRAS-EDNEVEVMMPKFVTATDFTLKGVLIQMGIRDL 368
            ....::.:..:|.       ::.|..:.|.:: .:.||:|.:|||..:..:.|..:|..:|:||:
Mouse   249 GTASVSQIEKHLN-------VKMLREWTNPSNMVEREVDVHIPKFSLSVKYDLNTLLKSLGMRDI 306

  Fly   369 FDENTANLDRMS--SGLFAKLVVHSTKIIVDEQGTTAGAVTEAALANKATP--PKFLLNRPFQYM 429
            |:...|:|..||  .||:...|||.:.:.|:|:||.|.|.|..:::.|..|  .:|..|.||.:.
Mouse   307 FNVANADLSGMSPDKGLYLSKVVHKSYVDVNEEGTEAAAATGESISVKRLPVTVQFTANCPFLFF 371

  Fly   430 IVEKATGLLLFAGQVRNP 447
            |.:: :|.:||||:..:|
Mouse   372 IWDE-SGNILFAGKFASP 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 109/400 (27%)
Serpinb11NP_080143.1 SERPIN 4..388 CDD:294093 110/406 (27%)
RCL. /evidence=ECO:0000250 338..362 8/23 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.