DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and SERPINE3

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001094790.1 Gene:SERPINE3 / 647174 HGNCID:24774 Length:424 Species:Homo sapiens


Alignment Length:394 Identity:113/394 - (28%)
Similarity:185/394 - (46%) Gaps:51/394 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 DFALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRINVEDEKLRGAYK 142
            :|||.|.|  ||...:...:|:|||..|...|.:|..|:||.|..||..:|...|.|::::    
Human    32 EFALHLYQ--SVAACRNETNFVISPAGVSLPLEILQFGAEGSTGQQLADALGYTVHDKRVK---- 90

  Fly   143 VWSSFLNITTSTI-------EVATLQAIYTGKGYPIKNNYRDAIQ---NYNVQPMEVDFYSPDS- 196
               .||:...:|:       |:....:::...|.|:...:.:.:.   |.:::|  .|...|:| 
Human    91 ---DFLHAVYATLPTSSQGTEMELACSLFVQVGTPLSPCFVEHVSWWANSSLEP--ADLSEPNST 150

  Fly   197 VIQINEDTNRTTRGLIPYTILPQDVYG----------AKMFLLSSLYFKGQWKFPFNKTLTREEP 251
            .||.:|..:|.|.|..|    .:...|          |::.|:|::.|:|.|:..|:.|.|:..|
Human   151 AIQTSEGASRETAGGGP----SEGPGGWPWEQVSAAFAQLVLVSTMSFQGTWRKRFSSTDTQILP 211

  Fly   252 FFSESGEVIGKIPMMVQ--EANFAYVSNVEGLDGYVLELPYGTQDRLAMIVVLPK-RGFKLNDVA 313
            |....|.|: ::|||.|  |.|:....:..|....|||||| ....:::.:|||: :...|:.:.
Human   212 FTCAYGLVL-QVPMMHQTTEVNYGQFQDTAGHQVGVLELPY-LGSAVSLFLVLPRDKDTPLSHIE 274

  Fly   314 NNLKALGLRPILQRLAAFRNRASEDNEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANLDR 378
            .:|.|..:......|...|        ::|.:|:|.....|.||.:|...|:.||||...|||..
Human   275 PHLTASTIHLWTTSLRRAR--------MDVFLPRFRIQNQFNLKSILNSWGVTDLFDPLKANLKG 331

  Fly   379 MS--SGLFAKLVVHSTKIIVDEQGTTAGAVTEAALANKATPPKFLLNRPFQYMIVEKATGLLLFA 441
            :|  .|.:....:|..||.|.|:||.|...|...|..::..|.|..:|||.|.:.|..||:.:|.
Human   332 ISGQDGFYVSEAIHKAKIEVLEEGTKASGATALLLLKRSRIPIFKADRPFIYFLREPNTGITVFF 396

  Fly   442 GQVR 445
            .:::
Human   397 DRIQ 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 113/391 (29%)
SERPINE3NP_001094790.1 SERPIN 31..399 CDD:238101 113/391 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 143..174 10/34 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.