DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and Serpina3i

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_017170641.1 Gene:Serpina3i / 628900 MGIID:2182841 Length:457 Species:Mus musculus


Alignment Length:417 Identity:101/417 - (24%)
Similarity:190/417 - (45%) Gaps:41/417 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 IQSMRSNFDTDVLVSISQGVQDFALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETR 121
            :..::.|..:...::::....|||..|.:::  .::..:::.:.||||:::.|.||..|::..|.
Mouse    57 VHEVQENITSGDSLTVASSNTDFAFSLYRKL--VLKNPDENVVFSPFSIFTALALLSLGAKSNTL 119

  Fly   122 NQLKKSLRINV---EDEKLRGAYKVWSSFLNITTSTIEVATLQAIYTGKGYPIKNNYRD-AIQNY 182
            .::.:.|:.|:   .:..:...::.....|:.....::::|..|::..|...|...::: |...|
Mouse   120 KEILEGLKFNLTETPEPDIHQGFRYLLDLLSQPGDQVQISTGSALFVEKHLQILAEFKEKARALY 184

  Fly   183 NVQPMEVDFYSPDSVIQ-INEDTNRTTRGLIPYTILPQDVYGAKMFLLSSLYFK----------- 235
            ..:....||..|....: ||:..:..|:|.|...|...| ....|.|::.:|||           
Mouse   185 QAEAFTADFLQPCQAKKLINDYVSNQTQGKIKELISDLD-KSTLMVLVNYIYFKGGRGHCLGVER 248

  Fly   236 ---GQWKFPFNKTLTREEPFFSESGEVIGKIPMM-VQEANFAYVSNVEGLDGYVLELPYGTQDRL 296
               |:||.||:...|....|:.:....: |:||| ::|....|..:.| |...|:||.|  ....
Mouse   249 EELGKWKMPFDPRDTFNSKFYLDEKRSV-KVPMMKIEELTTPYFRDDE-LSCSVVELKY--TGNA 309

  Fly   297 AMIVVLPKRGFKLNDVANNLKALGLRPILQRLAAFRNRASEDNEVEVMMPKFVTATDFTLKGVLI 361
            :.:.:||.:| |:..|..:|..       :.|..::|........|:.:|||..:.|::|:.||.
Mouse   310 SALFILPDQG-KMQQVETSLHP-------ETLRKWKNSLKPSRISELHLPKFSISNDYSLEHVLP 366

  Fly   362 QMGIRDLFDENTANLDRMSSGLFAKL--VVHSTKIIVDEQGTTAGAVTEAAL---ANKATPPKFL 421
            .:|||::|... |:|..::..:..::  |||...:.|.|.||.|.|.|...:   ..|.......
Mouse   367 VLGIREVFSMQ-ADLSAITGTMDLRVSQVVHKAVLDVTETGTEAAAATGVKVNLRCGKIYSMTIY 430

  Fly   422 LNRPFQYMIVEKATGLLLFAGQVRNPK 448
            ..|||..:|.:..|.:.||..:|.|||
Mouse   431 FKRPFLIIISDINTHIALFMAKVTNPK 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 96/393 (24%)
Serpina3iXP_017170641.1 serpinA3_A1AC 62..457 CDD:381019 99/410 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.