DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and LOC569077

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001188383.1 Gene:LOC569077 / 569077 -ID:- Length:384 Species:Danio rerio


Alignment Length:401 Identity:112/401 - (27%)
Similarity:184/401 - (45%) Gaps:46/401 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 ISQGVQDFALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRI-NVEDE 135
            :|:....|||||.|.:|....:.|  ...||.|:.::|.::|.|:.|:|..::::.|.: :|.| 
Zfish     4 VSRANSLFALDLYQALSASSAEGN--IFFSPLSISAVLSMVYLGARGDTAAEMERVLSLSSVSD- 65

  Fly   136 KLRGAYKVWSSFLNITTSTIEVATLQAIYTGKGYPIKNNYRDA-IQNYNVQPMEVDFY--SPDSV 197
             :...::...|.:|..:::..:.....:|..|.:.......|: ::.|:.:...|||.  |..|.
Zfish    66 -VHSHFESLISSINSPSASYILRLANRLYGEKSFSFLPECLDSTMKLYHAELQTVDFIGASEGSR 129

  Fly   198 IQINEDTNRTTRGLIPYTILPQDVYG-AKMFLLSSLYFKGQWKFPFNKTLTREEPF---FSESGE 258
            ..||:...:.|...|...:.|..|.. .::.|::::||||:|...|....|||..|   ..||..
Zfish   130 QLINKWVEKQTENKIRDLLKPGMVTTMTRLALVNAIYFKGKWTHTFQAKYTREMAFKINQKESHP 194

  Fly   259 V-----IGKIPMMVQEANFAYVSNVEGLDGY---VLELPYGTQDRLAMIVVLPKRGFKLNDVANN 315
            |     :.|:|...             |..|   |||||| .|..|:|:::||.   :..|.::.
Zfish   195 VRMMHQLNKLPFRC-------------LPEYKLQVLELPY-IQQELSMLILLPD---ETKDGSDP 242

  Fly   316 LKALGLRPILQRLAAFRNRASEDNE--VEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANLDR 378
            |..|.....|::|..:.||...|.:  |.|.:|||....:..|...|.:||:..:|.|..|:|..
Zfish   243 LLKLEKELTLEKLLDWTNRDKMDTQGAVIVHLPKFKLEIESCLSETLEKMGMSSVFQETKADLTG 307

  Fly   379 MSS--GLFAKLVVHSTKIIVDEQGTTAGAVTEAALANKATP---PK--FLLNRPFQYMIVEKATG 436
            |.|  |||...|:|...:.|.|:||.|.|.|...:.....|   |:  |..:.||.:.|....:.
Zfish   308 MGSNGGLFVSAVIHKAFVDVSEEGTEAAAATCVYIITSYVPRPEPRYYFTADHPFMFFIRHNPSN 372

  Fly   437 LLLFAGQVRNP 447
            .:||.|:.|:|
Zfish   373 NILFLGRYRSP 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 109/393 (28%)
LOC569077NP_001188383.1 SERPIN 5..383 CDD:294093 111/398 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.