DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and serpinb1l2

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001038636.1 Gene:serpinb1l2 / 568898 ZFINID:ZDB-GENE-041001-117 Length:382 Species:Danio rerio


Alignment Length:398 Identity:120/398 - (30%)
Similarity:187/398 - (46%) Gaps:42/398 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 ISQGVQDFALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRI-NVEDE 135
            :|:....|||||.:.:|....:.|  ...||.|:.:.|.::|.|:.|:|..:::|.|.. :|.| 
Zfish     4 VSRANSLFALDLYRALSASSAEGN--IFFSPLSISAALSMVYLGARGDTAGEMEKVLCFSSVSD- 65

  Fly   136 KLRGAYKVWSSFLNITTSTIEVATLQAIYTGKGYPIKNNYRDA-IQNYNVQPMEVDFY--SPDSV 197
             ....:|...|.:|..:::..:.....:|..|.:.....|.|: ::.|:.:|..|||.  :.||.
Zfish    66 -FHAHFKTLISSINSPSASYILRLANRLYGEKTFSFLPMYVDSTMKLYHAEPQTVDFIRAADDSR 129

  Fly   198 IQINEDTNRTTRGLIPYTILPQDVYG-AKMFLLSSLYFKGQWKFPFNKTLTREEPFFSESGEVIG 261
            ..||:...:.|...|...:.|..|.. .::.|::::||||.|...|:...|:|.||.....| ..
Zfish   130 QFINKWVEKQTENQIKDLLQPGVVNEMTRLLLVNAIYFKGNWMHTFDAHATKEMPFKINQNE-SR 193

  Fly   262 KIPMMVQEANFAYVSNVEGLDGY---VLELPYGTQDRLAMIVVLP---KRG----FKLNDVANNL 316
            .:.||.|..||.|    ..:..|   |||||| ||..|:|:::||   |.|    .||....|  
Zfish   194 PVQMMDQVENFPY----RCIPEYKLQVLELPY-TQQELSMLILLPDEIKYGSDPLLKLESELN-- 251

  Fly   317 KALGLRPILQRLAAFRNRASED--NEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANLDRM 379
                    ||:|..:.:|...|  .::.|.:|||....:..|...|.:||:..:|.|..|:|..|
Zfish   252 --------LQKLLDWTSRGKMDTWRKIIVRLPKFKLEIESCLSETLEKMGMSSVFQETKADLTGM 308

  Fly   380 SS--GLFAKLVVHSTKIIVDEQGTTAGAVTEAAL---ANKATPPKFLLNRPFQYMIVEKATGLLL 439
            ||  |||...|:|...:.|:|:||.|.|.|...|   |.:.....|:.:.||.:.|....|..:|
Zfish   309 SSNGGLFLSAVIHKAFVEVNEEGTEAAAATALLLPISACQGAFHDFIADHPFMFFIRHNPTNSIL 373

  Fly   440 FAGQVRNP 447
            |.|:.|.|
Zfish   374 FLGRFRAP 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 117/390 (30%)
serpinb1l2NP_001038636.1 SERPIN 5..381 CDD:294093 119/395 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.