DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and si:ch211-186e20.7

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_021329695.1 Gene:si:ch211-186e20.7 / 566630 ZFINID:ZDB-GENE-110407-6 Length:410 Species:Danio rerio


Alignment Length:453 Identity:132/453 - (29%)
Similarity:200/453 - (44%) Gaps:65/453 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LMLWIPLLLG-AIFLCSADPQNNQAPLQLSVGNPLTAFTAPTAFQSGVSHIQSMRSNFDTDVLVS 71
            ::|||   .| ||.:|     .||..||..   |::|                        .|.|
Zfish     6 VLLWI---FGFAIVVC-----GNQETLQQP---PISA------------------------KLPS 35

  Fly    72 ISQGVQDFALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRINVEDEK 136
            :.....|||..|.:|:....:..:|:...|||||...|..|..|:.|:|:.||...:..|.....
Zfish    36 LINMNNDFAFHLYKRVIESPDYQSKNIFFSPFSVSIALSELSLGAGGDTKQQLLSGIGYNSTTFS 100

  Fly   137 LRGAYKVWSSFL----NITTSTIEVATLQAIYTGKGY-PIKNNYRDAIQNYNVQPMEVDFYSPDS 196
            ....::::.|.|    |.|...|:|.|  |:|....: |......|..:.|:.....|||...::
Zfish   101 TEEMHQLFHSLLEDIGNRTGVDIDVGT--ALYASDRFKPHSKFLEDMKEFYHSDGFTVDFRVKET 163

  Fly   197 VIQINEDTNRTTRGLIPYTI--LPQDVYGAKMFLLSSLYFKGQWKFPFNKTLTREEPFFSESGEV 259
            |.|||....:.|:|.....:  |.:|..   ||||:.:||||:|..||....|||..|..:....
Zfish   164 VDQINNYAKKKTQGKFNQAVDDLEEDTL---MFLLTYIYFKGKWDKPFKPEKTRESTFHIDDKTT 225

  Fly   260 IGKIPMMVQEANFAYVSNVEGLDGYVLELPYGTQDRLAMIVVLP--KRGFKLNDVANNLKALGLR 322
            : .:.||.|........:.| |...||.|.|  :|..:|.:.:|  |...|      |:|.|.:.
Zfish   226 V-PVQMMHQYERLKVFYDAE-LSTKVLCLDY--KDSFSMFLAVPDDKMEHK------NIKDLEMT 280

  Fly   323 PILQRLAAFRNRASEDNEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANLDRMS-SGLFAK 386
            ...|....:| |::....|::.:||....|.::||.:|..||:.|:|.:. ||...:| ..:|..
Zfish   281 VSRQHFEKWR-RSAFKKTVDIYVPKLSLKTSYSLKDILKGMGMADMFSDK-ANFTGVSEEKIFVS 343

  Fly   387 LVVHSTKIIVDEQGTTAGAVTEAALANKATPPKFLL--NRPFQYMIVEKATGLLLFAGQVRNP 447
            .|:|...:.:|||||||.|||..::..:...|..:|  ||||...|.::....:||.|:|.||
Zfish   344 KVLHKATLDIDEQGTTAAAVTGVSMRVRLHNPLSILKFNRPFMVFITDQTNDNILFFGKVVNP 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 114/380 (30%)
si:ch211-186e20.7XP_021329695.1 alpha-1-antitrypsin_like 39..403 CDD:239011 114/380 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.