DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and serpine3

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001116709.1 Gene:serpine3 / 556612 ZFINID:ZDB-GENE-050309-223 Length:417 Species:Danio rerio


Alignment Length:400 Identity:106/400 - (26%)
Similarity:175/400 - (43%) Gaps:54/400 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 FALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRINVEDEKLRGAYKV 143
            |.:.|.|.::....|:|  .::||.||...|.||..|:.|.|..||:.:|..:|.|.:::.....
Zfish    37 FGISLYQTLTETENKSN--LIVSPASVSLCLGLLQLGARGNTLVQLEGTLGYDVNDVRVQNILSR 99

  Fly   144 WSSFLNITTSTIEVATLQAIYTGKGYPIKNNY-RDAIQNYNVQPMEVDFYSP------------- 194
            ....|..::..:.:....|::...|..:...: :.|:...|...:.|:|.:|             
Zfish   100 PQGDLANSSEGLRLQLANALFIQTGVKLLPEFTQHALGWGNTSLLSVNFSNPNHTHSRLQQWAHY 164

  Fly   195 ----DSVIQINEDTNRT-------TRGLIPYTILPQD--VYGAKMFLLSSLYFKGQWKFPFNKTL 246
                |..:|..|:.:.:       ||         ||  :|   |.|:|:|.|.|.|:..|..|.
Zfish   165 QSKADDHLQTREELHHSSGEEEEATR---------QDHLLY---MALVSTLVFHGAWQKQFLFTE 217

  Fly   247 TREEPFFSESGEVIGKIPMMVQ--EANFAYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGFKL 309
            |:..||....|..: |:|||.|  |.|..:.......:..|||||| ....|.::|.||      
Zfish   218 TQNLPFTFSDGSTV-KVPMMYQSSEVNIGHFRLPSEQEYTVLELPY-LDHSLRLLVALP------ 274

  Fly   310 NDVANNLKALGLRPILQRLAAFRNRASEDNEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTA 374
            :|....|..|. :.|..|.....:......::::.:|:|...:...||.||..:|:.|:|..:.|
Zfish   275 SDRKTPLSQLE-KQITARAVGLWDTGLRRTKMDIFLPRFKMQSKINLKPVLQSLGVSDIFSPSAA 338

  Fly   375 NLDRMS--SGLFAKLVVHSTKIIVDEQGTTAGAVTEAALANKATPPKFLLNRPFQYMIVEKATGL 437
            :...:|  .|:|.....|..:|.|.|.||.|.:.|...|..::....|..:|||.:::.:.:||.
Zfish   339 DFRGISDTDGIFVSEAFHEARIEVTEAGTKAASATAMVLLKRSRSAVFKADRPFLFILRQISTGS 403

  Fly   438 LLFAGQVRNP 447
            |||.|:|.||
Zfish   404 LLFIGRVVNP 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 103/395 (26%)
serpine3NP_001116709.1 Serpin 35..413 CDD:278507 104/398 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.