DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and Serpinb9h

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001357856.1 Gene:Serpinb9h / 544923 MGIID:3709608 Length:377 Species:Mus musculus


Alignment Length:395 Identity:107/395 - (27%)
Similarity:187/395 - (47%) Gaps:38/395 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 SISQGVQDFALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRINVEDE 135
            ::||....||:.||:.:.  .:..:|:...||.|:.|.|.::..|::|:|..|:.::|.:| .||
Mouse     3 TLSQANGTFAIHLLKVLC--QDNPSKNVCYSPMSISSALAMVLLGAKGDTAVQICQALHLN-PDE 64

  Fly   136 KLRGAYKVWSSFLNITTSTIEVATL-QAIYTGKGYPIKNNYRDA-IQNYNVQPMEVDF--YSPDS 196
            .:...:::....||...:.....|: ..::......:...:::: ::.|:.:..::.|  .:.:|
Mouse    65 DVHQGFQLLLHNLNKQNNQKYCLTMANRLFVENTCELLPTFKESCLKFYHSEMEQLSFAEAAEES 129

  Fly   197 VIQINEDTNRTTRGLIPYTILPQDVYGA--KMFLLSSLYFKGQWKFPFNKTLTREEPFFSESGEV 259
            ...||...::.|.|.|| .:|.:|...:  ::.|.::|||.|.|...|.|..|:|.||.....|.
Mouse   130 RQHINMWVSKQTNGKIP-DLLSKDSVNSQTRLILANALYFHGTWCKRFEKNRTKEMPFKINKKET 193

  Fly   260 IGKIPMMVQEANF--AYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGFKLNDVANNLKALGLR 322
             ..:.||.:|...  |||..::   ..||.:||...| |..:|:||..|..::.|.|||      
Mouse   194 -RPVQMMWREDTLFHAYVKEIQ---AQVLVMPYEGID-LNFVVLLPDEGVDISKVENNL------ 247

  Fly   323 PILQRLAA-----FRNRASEDNEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANLDRMSS- 381
             ..::|.|     |.||    .|..|..|||....|:.:..:|..:||.::||.:.|:|..||: 
Mouse   248 -TFEKLTAWTKPEFMNR----TEFHVYYPKFQLQEDYDMNSLLQHLGILNVFDGSKADLSGMSTK 307

  Fly   382 -GLFAKLVVHSTKIIVDEQGTTAGAVTEAA---LANKATPPKFLLNRPFQYMIVEKATGLLLFAG 442
             .|.....||...:.|:|:||.|.|.:...   |.:...|..|..:.||.:.|:...|..:||.|
Mouse   308 ENLCLSEFVHKCVVEVNEEGTEAAAASAVEFIFLCSGPDPETFCADHPFLFFIMHSTTNSILFCG 372

  Fly   443 QVRNP 447
            :..:|
Mouse   373 RFSSP 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 104/386 (27%)
Serpinb9hNP_001357856.1 serpinB 7..374 CDD:381072 104/386 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.