DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and SERPINI2

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001012303.2 Gene:SERPINI2 / 5276 HGNCID:8945 Length:405 Species:Homo sapiens


Alignment Length:390 Identity:101/390 - (25%)
Similarity:185/390 - (47%) Gaps:45/390 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 DFALDLLQRISVEVEKANKDFMI-SPFSVWSLLVLLYEGSEGETRNQLKKSLRINVEDEKLRG-A 140
            :||:||.|.:|:    ::||.:| ||..:..:|.::..|::|:.:.|::::|:   :.|...| .
Human    28 EFAVDLYQEVSL----SHKDNIIFSPLGITLVLEMVQLGAKGKAQQQIRQTLK---QQETSAGEE 85

  Fly   141 YKVWSSFLNITTSTIEVATL---QAIYTGKGYPIKNNYRDAIQNYNVQPME-VDFYSPDSVIQ-I 200
            :.|..||.:..:...:..|.   .|:|..:|:.:|..|....:.:....:: |||....:..: |
Human    86 FFVLKSFFSAISEKKQEFTFNLANALYLQEGFTVKEQYLHGNKEFFQSAIKLVDFQDAKACAEMI 150

  Fly   201 NEDTNRTTRGLIPYTILPQDVYGAKMF-------LLSSLYFKGQWKFPFNKTLTREEPFFSESGE 258
            :....|.|.|.|      :|::..:.|       |::::||||.||..|.|..|:...|..::|.
Human   151 STWVERKTDGKI------KDMFSGEEFGPLTRLVLVNAIYFKGDWKQKFRKEDTQLINFTKKNGS 209

  Fly   259 VIGKIPMM--VQEANFAYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGFKLNDVANNLKALGL 321
            .: |||||  :....:.|.|. ..|:..||||.| ..|..::|::||..|..:.:|.   |.:..
Human   210 TV-KIPMMKALLRTKYGYFSE-SSLNYQVLELSY-KGDEFSLIIILPAEGMDIEEVE---KLITA 268

  Fly   322 RPILQRLAAFRNRASEDNEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANLDRM--SSGLF 384
            :.||:.|:..     ::.|||:.:|:|........|.||..:.|.::| ....:|..:  ||.::
Human   269 QQILKWLSEM-----QEEEVEISLPRFKVEQKVDFKDVLYSLNITEIF-SGGCDLSGITDSSEVY 327

  Fly   385 AKLVVHSTKIIVDEQGTTAGAVT--EAALANKATPPKFLLNRPFQYMIVEKATGLLLFAGQVRNP 447
            ...|.......::|.|:.|...|  ...:.......:|:.|.||.:::....|..:||.|:|.||
Human   328 VSQVTQKVFFEINEDGSEAATSTGIHIPVIMSLAQSQFIANHPFLFIMKHNPTESILFMGRVTNP 392

  Fly   448  447
            Human   393  392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 98/385 (25%)
SERPINI2NP_001012303.2 serpinI2_pancpin 23..392 CDD:381042 99/388 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.