DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and SERPINB13

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001294852.1 Gene:SERPINB13 / 5275 HGNCID:8944 Length:400 Species:Homo sapiens


Alignment Length:418 Identity:110/418 - (26%)
Similarity:184/418 - (44%) Gaps:69/418 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 LDLLQRISV--------EVEKANK-DFMISPFSVWSLLVLLYEGSEGETRNQLK---------KS 127
            :|.|..:|.        |::|.|. :...||..:.:.:.::..|:.|.|.:||:         ||
Human     1 MDSLGAVSTRLGFDLFKELKKTNDGNIFFSPVGILTAIGMVLLGTRGATASQLEEVFHSEKETKS 65

  Fly   128 LRINVED-------------EKLRGAYKVWSSFL---NITTSTIEVATLQAIYTGKGYPIKNNYR 176
            .||..|:             |.....::.:..||   :..|:..|:.....::..|.|.....|.
Human    66 SRIKAEEKEVVRIKAEGKEIENTEAVHQQFQKFLTEISKLTNDYELNITNRLFGEKTYLFLQKYL 130

  Fly   177 DAIQNYNVQPME-VDFY--SPDSVIQIN----EDTNRTTRGLIPYTILPQDVYGAKMFLLSSLYF 234
            |.::.|....:| |||.  :.:|..:||    ..||...:.|.|...:..   ..|:.|::.:||
Human   131 DYVEKYYHASLEPVDFVNAADESRKKINSWVESKTNEKIKDLFPDGSISS---STKLVLVNMVYF 192

  Fly   235 KGQWKFPFNKTLTREEPFFSESGEVIGKIPMMVQEANFAYVSNVEGLDGYVLELPYGTQDRLAMI 299
            ||||...|.|..|:||.|:... .....:.||.|..:|:: :.:|.|...:|.:||...| |:|.
Human   193 KGQWDREFKKENTKEEKFWMNK-STSKSVQMMTQSHSFSF-TFLEDLQAKILGIPYKNND-LSMF 254

  Fly   300 VVLPKRGFKLNDVANNLKALGLRPILQRLAAFR------NRASEDNEVEVMMPKFVTATDFTLKG 358
            |:||      ||:.      ||..|:.:::..:      ....|:.:|.:.:|:|.....:.|:.
Human   255 VLLP------NDID------GLEKIIDKISPEKLVEWTSPGHMEERKVNLHLPRFEVEDGYDLEA 307

  Fly   359 VLIQMGIRDLFDENTANLDRMS--SGLFAKLVVHSTKIIVDEQGTTAGAVTEAALANKATP--PK 419
            ||..||:.|.|.|:.|:...||  |||:|:..:||:.:.|.|:||.|.|.|.......:.|  ..
Human   308 VLAAMGMGDAFSEHKADYSGMSSGSGLYAQKFLHSSFVAVTEEGTEAAAATGIGFTVTSAPGHEN 372

  Fly   420 FLLNRPFQYMIVEKATGLLLFAGQVRNP 447
            ...|.||.:.|....:..:||.|:..:|
Human   373 VHCNHPFLFFIRHNESNSILFFGRFSSP 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 109/413 (26%)
SERPINB13NP_001294852.1 SERPIN 4..400 CDD:294093 108/413 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.