DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and SERPINI1

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001116224.1 Gene:SERPINI1 / 5274 HGNCID:8943 Length:410 Species:Homo sapiens


Alignment Length:409 Identity:107/409 - (26%)
Similarity:199/409 - (48%) Gaps:41/409 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 FDTDVLVSISQG-------VQDFALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETR 121
            |...||.|::.|       :.|.::::..|:....|..|  .:.||.|:...:.::..|::|.|:
Human     7 FSLLVLQSMATGATFPEEAIADLSVNMYNRLRATGEDEN--ILFSPLSIALAMGMMELGAQGSTQ 69

  Fly   122 NQLKKSLRINVEDEKLRGAYKVWSSFLNITTS-----TIEVATLQAIYTGKGYPIKNNYRDAIQN 181
            .:::.|:  ..:..|....:.....|.|:.|:     .:::|  .:::...|:.:...:...::.
Human    70 KEIRHSM--GYDSLKNGEEFSFLKEFSNMVTAKESQYVMKIA--NSLFVQNGFHVNEEFLQMMKK 130

  Fly   182 Y-NVQPMEVDFYSPDSVIQ-INEDTNRTTRGLIPYTILPQDVYGAK-MFLLSSLYFKGQWKFPFN 243
            | |.....|||....:|.. ||:.....|..|:...:.|:|...|. :.|::::||||.||..|.
Human   131 YFNAAVNHVDFSQNVAVANYINKWVENNTNNLVKDLVSPRDFDAATYLALINAVYFKGNWKSQFR 195

  Fly   244 KTLTREEPFFSESGEVIGKIPMMVQEANFAY-----VSNVEGLDGYVLELPYGTQDRLAMIVVLP 303
            ...||...|..:....: :||||.|:..|.|     .||..|....|||:|| ..|.::|::||.
Human   196 PENTRTFSFTKDDESEV-QIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPY-EGDEISMMLVLS 258

  Fly   304 KRGFKLNDVANNLKALGLRPILQRLAAFRNRASEDNEVEVMMPKFVTATDFTLKGVLIQMGIRDL 368
            ::...|..:...:||       |.:..:.|...: .:|||.:|:|....:..||.||..:||.::
Human   259 RQEVPLATLEPLVKA-------QLVEEWANSVKK-QKVEVYLPRFTVEQEIDLKDVLKALGITEI 315

  Fly   369 FDENTANLDRMSSG--LFAKLVVHSTKIIVDEQGTTAGAVT-EAALANKAT-PPKFLLNRPFQYM 429
            |.:: |||..:|..  :|....:|.:.:.|:|:|:.|.||: ..|::..|. .|:.:::.||.::
Human   316 FIKD-ANLTGLSDNKEIFLSKAIHKSFLEVNEEGSEAAAVSGMIAISRMAVLYPQVIVDHPFFFL 379

  Fly   430 IVEKATGLLLFAGQVRNPK 448
            |..:.||.:||.|:|.:|:
Human   380 IRNRRTGTILFMGRVMHPE 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 101/392 (26%)
SERPINI1NP_001116224.1 neuroserpin 23..410 CDD:239003 102/393 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.