DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and SERPINB9

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_004146.1 Gene:SERPINB9 / 5272 HGNCID:8955 Length:376 Species:Homo sapiens


Alignment Length:390 Identity:110/390 - (28%)
Similarity:200/390 - (51%) Gaps:29/390 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 SISQGVQDFALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRINVEDE 135
            ::|.....||:.||:.:.  .:..:.:...||.|:.|.|.::..|::|.|..|:.::|.:|.| |
Human     3 TLSNASGTFAIRLLKILC--QDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSLNTE-E 64

  Fly   136 KLRGAYKVWSSFLNITTSTIEVATLQAIYTGKGYPIKNNYRDA-IQNYNVQPMEVDFY--SPDSV 197
            .:..|::...:.:|...:...:.|...::..|.....:.:::: :|.|:.:..|:.|.  :.:|.
Human    65 DIHRAFQSLLTEVNKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELSFIRAAEESR 129

  Fly   198 IQINEDTNRTTRGLIPYTILPQDVYGA--KMFLLSSLYFKGQWKFPFNKTLTREEPFFSESGEVI 260
            ..||...::.|.|.|. .:||.....|  ::.|::::||||:|..||::|.|||.| |..:.|..
Human   130 KHINTWVSKKTEGKIE-ELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTREMP-FKINQEEQ 192

  Fly   261 GKIPMMVQEANF--AYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGFKLNDVANNLKALGLRP 323
            ..:.||.|||.|  |:|..|.   ..:|||||..:: |:::|:||..|.:|:.|..:|       
Human   193 RPVQMMYQEATFKLAHVGEVR---AQLLELPYARKE-LSLLVLLPDDGVELSTVEKSL------- 246

  Fly   324 ILQRLAAF-RNRASEDNEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANLDRMSS--GLFA 385
            ..::|.|: :....:..||||::|||....|:.::.||..:||.|.|.:..|:|..||:  .|..
Human   247 TFEKLTAWTKPDCMKSTEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADLSAMSAERDLCL 311

  Fly   386 KLVVHSTKIIVDEQGTTAGAVTEAALANKA---TPPKFLLNRPFQYMIVEKATGLLLFAGQVRNP 447
            ...||.:.:.|:|:||.|.|.:...:..:.   :.|:|..:.||.:.|.......:||.|:..:|
Human   312 SKFVHKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFCADHPFLFFIRHNRANSILFCGRFSSP 376

  Fly   448  447
            Human   377  376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 108/381 (28%)
SERPINB9NP_004146.1 SERPIN 4..376 CDD:320777 109/387 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.