DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and SERPINB8

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001353127.1 Gene:SERPINB8 / 5271 HGNCID:8952 Length:374 Species:Homo sapiens


Alignment Length:386 Identity:104/386 - (26%)
Similarity:182/386 - (47%) Gaps:39/386 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 FALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRINVEDEKLRGAYKV 143
            ||:.|.:.:..|....|..|  ||.|:.|.|.:::.|::|.|..|:.::|.:..:.:..||...:
Human    11 FAISLFKILGEEDNSRNVFF--SPMSISSALAMVFMGAKGSTAAQMSQALCLYKDGDIHRGFQSL 73

  Fly   144 WSSFLNITTSTIEVATLQAIYTGKGYPIKNNYRDAIQNYNVQPMEVDFYSPDSV---IQINEDTN 205
            .|. :|.|.:...:.|...::..|......::::..|.:....:|...::.|:.   ..||:...
Human    74 LSE-VNRTGTQYLLRTANRLFGEKTCDFLPDFKEYCQKFYQAELEELSFAEDTEECRKHINDWVA 137

  Fly   206 RTTRGLIPY-----TILPQDVYGAKMFLLSSLYFKGQWKFPFNKTLTREEPFFSESGEVIGKIPM 265
            ..|.|.|..     |:.|.    .|:.|::::||||:|...|::..||...|  ::.|....:.|
Human   138 EKTEGKISEVLDAGTVDPL----TKLVLVNAIYFKGKWNEQFDRKYTRGMLF--KTNEEKKTVQM 196

  Fly   266 MVQEANF--AYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGFKLNDVANNLKALGLRPILQRL 328
            |.:||.|  .|...|.   ..|||||| .::.|:|:::||...   .|:|...|||    ..::.
Human   197 MFKEAKFKMGYADEVH---TQVLELPY-VEEELSMVILLPDDN---TDLAVVEKAL----TYEKF 250

  Fly   329 AAFRNRASE---DNEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANLDRMSSGLFAKL--V 388
            .|:.|  ||   .::|:|.:|:......:.|:..|.::|:.|.|||..|:...||:.....|  |
Human   251 KAWTN--SEKLTKSKVQVFLPRLKLEESYDLEPFLRRLGMIDAFDEAKADFSGMSTEKNVPLSKV 313

  Fly   389 VHSTKIIVDEQGTTAGAVTEAALANKAT--PPKFLLNRPFQYMIVEKATGLLLFAGQVRNP 447
            .|...:.|:|:||.|.|.|.....::.:  .|:|..:.||.:.|....|..:||.|:..:|
Human   314 AHKCFVEVNEEGTEAAAATAVVRNSRCSRMEPRFCADHPFLFFIRHHKTNCILFCGRFSSP 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 103/381 (27%)
SERPINB8NP_001353127.1 SERPIN 4..374 CDD:320777 103/384 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.