DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and SERPINB6

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_011512974.1 Gene:SERPINB6 / 5269 HGNCID:8950 Length:454 Species:Homo sapiens


Alignment Length:411 Identity:107/411 - (26%)
Similarity:189/411 - (45%) Gaps:42/411 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 GVSHIQSMRSNFDTDVLVSISQGVQDFALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSE 117
            |:.||:|.       ::..:::....|||:||:.:.   :..:|:...||.|:...|.::|.|::
Human    70 GLLHIKSA-------IMDVLAEANGTFALNLLKTLG---KDNSKNVFFSPMSMSCALAMVYMGAK 124

  Fly   118 GETRNQLKKSLRINVEDEKLRGAYKVWSSFLNITTSTIEVAT------LQAIYTGKGYPIKNNYR 176
            |.|..|:.:.|..|    |..|...:...|.::.|...:..|      ...::..|.....:::|
Human   125 GNTAAQMAQILSFN----KSGGGGDIHQGFQSLLTEVNKTGTQYLLRMANRLFGEKSCDFLSSFR 185

  Fly   177 DAIQN-YNVQPMEVDFYS--PDSVIQINEDTNRTTRGLIPYTILPQDVYG-AKMFLLSSLYFKGQ 237
            |:.|. |..:..|:||.|  ..|...||......|.|.|...:.|..|.. .::.|::::||:|.
Human   186 DSCQKFYQAEMEELDFISAVEKSRKHINTWVAEKTEGKIAELLSPGSVDPLTRLVLVNAVYFRGN 250

  Fly   238 WKFPFNKTLTREEPFFSESGEVIGKIPMMVQEANF--AYVSNVEGLDGYVLELPYGTQDRLAMIV 300
            |...|:|..| ||..|..|......:.||.:::.|  .|:..:   ...:|.|||..:: |.||:
Human   251 WDEQFDKENT-EERLFKVSKNEEKPVQMMFKQSTFKKTYIGEI---FTQILVLPYVGKE-LNMII 310

  Fly   301 VLPKRGFKLNDVANNLKALGLRPILQRLAAF-RNRASEDNEVEVMMPKFVTATDFTLKGVLIQMG 364
            :||       |...:|:.:......::...: |....::.||||.:|:|.....:.::.||..:|
Human   311 MLP-------DETTDLRTVEKELTYEKFVEWTRLDMMDEEEVEVSLPRFKLEESYDMESVLRNLG 368

  Fly   365 IRDLFDENTANLDRMS-SGLFAKLVVHSTKIIVDEQGTTAGAVTEAALANKAT--PPKFLLNRPF 426
            :.|.|:...|:...|| :.|....|||.:.:.|:|:||.|.|.|.|.:..:..  .|:|..:.||
Human   369 MTDAFELGKADFSGMSQTDLSLSKVVHKSFVEVNEEGTEAAAATAAIMMMRCARFVPRFCADHPF 433

  Fly   427 QYMIVEKATGLLLFAGQVRNP 447
            .:.|....|..:||.|:..:|
Human   434 LFFIQHSKTNGILFCGRFSSP 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 102/384 (27%)
SERPINB6XP_011512974.1 PAI-2 82..454 CDD:239013 102/390 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.