DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and SERPINB5

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_002630.2 Gene:SERPINB5 / 5268 HGNCID:8949 Length:375 Species:Homo sapiens


Alignment Length:379 Identity:91/379 - (24%)
Similarity:180/379 - (47%) Gaps:24/379 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 FALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRI-NVEDEKLRGAYK 142
            ||:||.:::..:....|  .:.||..:.:.|.|...|::|:|.|::.:.|.. ||:|...  .::
Human    11 FAVDLFKQLCEKEPLGN--VLFSPICLSTSLSLAQVGAKGDTANEIGQVLHFENVKDVPF--GFQ 71

  Fly   143 VWSSFLNITTSTIEVATLQAIYTGKGYPIKNNYRDAIQNYNVQPME-VDFYS--PDSVIQINEDT 204
            ..:|.:|..:|...:..::.:|..|...:...:..:.:....:.:| |||..  .::..|||...
Human    72 TVTSDVNKLSSFYSLKLIKRLYVDKSLNLSTEFISSTKRPYAKELETVDFKDKLEETKGQINNSI 136

  Fly   205 NRTTRGLIPYTILPQDVYG-AKMFLLSSLYFKGQWKFPFNKTLTREEPFFSESGEVIGKIPMMVQ 268
            ...|.|.....:....|.. .|:.::::.||.|:|...|:::.|:|.||.....:. ..:.||..
Human   137 KDLTDGHFENILADNSVNDQTKILVVNAAYFVGKWMKKFSESETKECPFRVNKTDT-KPVQMMNM 200

  Fly   269 EANFAYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGFKLNDVANNLKALGLRPILQRLAAFRN 333
            ||.|. :.|::.::..::|||:..: .|:|.::|||   .:.|.:..|:.:..:...:.|:.:.|
Human   201 EATFC-MGNIDSINCKIIELPFQNK-HLSMFILLPK---DVEDESTGLEKIEKQLNSESLSQWTN 260

  Fly   334 RASEDN-EVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANLDRMS--SGLFAKLVVHSTKII 395
            .::..| :|::.:|||........|..|..:|::.:|.|:|::...||  .|:....|:|...:.
Human   261 PSTMANAKVKLSIPKFKVEKMIDPKACLENLGLKHIFSEDTSDFSGMSETKGVALSNVIHKVCLE 325

  Fly   396 VDEQGTTAGAVTEAALANKATPPKFLLN--RPFQYMIVEKATGLLLFAGQVRNP 447
            :.|.|..:..|..|.:...    |..||  .||.|:|....|..::|.|:..:|
Human   326 ITEDGGDSIEVPGARILQH----KDELNADHPFIYIIRHNKTRNIIFFGKFCSP 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 90/374 (24%)
SERPINB5NP_002630.2 maspin_like 4..375 CDD:239012 90/377 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.