DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and SERPINA4

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001275961.1 Gene:SERPINA4 / 5267 HGNCID:8948 Length:464 Species:Homo sapiens


Alignment Length:419 Identity:106/419 - (25%)
Similarity:182/419 - (43%) Gaps:49/419 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 SGVSHIQSMRSNFDTDVLVSISQGVQDFALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGS 116
            |..||.|.:.:...:..| .|:....|||......|:.|.  ..|:...||.|:.:...:|..|:
Human    69 SNSSHQQILETGEGSPSL-KIAPANADFAFRFYYLIASET--PGKNIFFSPLSISAAYAMLSLGA 130

  Fly   117 EGETRNQLKKSLRINV----EDEKLRGAYKVWSSFLNITTSTIEVATLQAIYTGKGYPIKNNY-R 176
            ...:|:|:.:.|..|:    |.:..||...:..: ||:....:|.....|::..........: .
Human   131 CSHSRSQILEGLGFNLTELSESDVHRGFQHLLHT-LNLPGHGLETRVGSALFLSHNLKFLAKFLN 194

  Fly   177 DAIQNYNVQPMEVDFYSPDSVIQ-INEDTNRTTRGLIPYTI--LPQDVYGAKMFLLSSLYFKGQW 238
            |.:..|..:....:||.....|| ||:...:.|||.|...:  |.:||.   |.|::.:|||..|
Human   195 DTMAVYEAKLFHTNFYDTVGTIQLINDHVKKETRGKIVDLVSELKKDVL---MVLVNYIYFKALW 256

  Fly   239 KFPFNKTLTREEPFFSESGEVIGKIPMMVQEANFAYVSNVEGLDGYVLELPYGTQDRLAMIVVLP 303
            :.||..:.|..:.|:.:....: ::|||:|:....:..:...|...||.:.|  :....:..:||
Human   257 EKPFISSRTTPKDFYVDENTTV-RVPMMLQDQEHHWYLHDRYLPCSVLRMDY--KGDATVFFILP 318

  Fly   304 KRGFKLNDVANNLKALGLRPILQRLAAFRNRASEDN---EVEVMMPKFVTATDFTLKGVLIQMGI 365
            .:| |:.::...|..       :.|..:.|...:.|   ::|:.:|||..:..:.|..:|.::|.
Human   319 NQG-KMREIEEVLTP-------EMLMRWNNLLRKRNFYKKLELHLPKFSISGSYVLDQILPRLGF 375

  Fly   366 RDLFDENTANLDRMS--SGLFAKLVVHSTKIIVDEQGTTAGAVTEAALANKATPPKFL------- 421
            .|||.: .|:|..::  ..|.|....|...:.|||.||.|.|.|..|:       ||.       
Human   376 TDLFSK-WADLSGITKQQKLEASKSFHKATLDVDEAGTEAAAATSFAI-------KFFSAQTNRH 432

  Fly   422 ---LNRPFQYMIVEKATGLLLFAGQVRNP 447
               .||||..:|...:|..:||.|:|.:|
Human   433 ILRFNRPFLVVIFSTSTQSVLFLGKVVDP 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 98/391 (25%)
SERPINA4NP_001275961.1 alpha-1-antitrypsin_like 91..458 CDD:239011 98/391 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.