DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and SERPINE1

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001373389.1 Gene:SERPINE1 / 5054 HGNCID:8583 Length:492 Species:Homo sapiens


Alignment Length:470 Identity:112/470 - (23%)
Similarity:200/470 - (42%) Gaps:111/470 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKIADCLMLWIPLLLGAIFLCSADPQNNQAPLQLSVGNPLTAFTAPTAFQSGVSHIQSMRSNFD 65
            |.....||:|.:.|:.|.               ..:|.:|          .|.|:|:.|      
Human     3 MSPALTCLVLGLALVFGE---------------GSAVHHP----------PSYVAHLAS------ 36

  Fly    66 TDVLVSISQGVQDFALDLLQRISVEVEKANKD--FMISPFSVWSLLVLLYEGSEGETRNQLKKSL 128
                        ||.:    |:..:|.:|:||  .:.||:.|.|:|.:|...:.|||:.|::.::
Human    37 ------------DFGV----RVFQQVAQASKDRNVVFSPYGVASVLAMLQLTTGGETQQQIQAAM 85

  Fly   129 RINVEDE----KLRGAYK----VWSSFLNITTSTIEVATLQAIYTGKGYPIKNN--------YRD 177
            ...::|:    .||..||    .|:.        .|::|..||:..:...:...        :|.
Human    86 GFKIDDKGMAPALRHLYKELMGPWNK--------DEISTTDAIFVQRDLKLVQGFMPHFFRLFRS 142

  Fly   178 AIQNYNVQPMEVDFYSPDSVIQINEDTNRT-TRGLIPYTILPQDVYG-------AKMFLLSSLYF 234
            .::       :|||...:....|..|..:| |:|:|      .::.|       .::.|:::|||
Human   143 TVK-------QVDFSEVERARFIINDWVKTHTKGMI------SNLLGKGAVDQLTRLVLVNALYF 194

  Fly   235 KGQWKFPFNKTLTREEPFFSESGEVIGKIPMMVQEANFAYVSNVEGLDGY---VLELPYGTQDRL 296
            .||||.||..:.|....|....|..: .:|||.|...|.| :.....||:   :||||| ..|.|
Human   195 NGQWKTPFPDSSTHRRLFHKSDGSTV-SVPMMAQTNKFNY-TEFTTPDGHYYDILELPY-HGDTL 256

  Fly   297 AMIVVLP-KRGFKLNDVANNLKALGLRPILQRLAAFRNRASEDNEVEVMMPKFVTATDFTLKGVL 360
            :|.:..| ::...|:.:.|.|.|       |.::.::...:....: :::|||...|:..|:..|
Human   257 SMFIAAPYEKEVPLSALTNILSA-------QLISHWKGNMTRLPRL-LVLPKFSLETEVDLRKPL 313

  Fly   361 IQMGIRDLFDENTANLDRMS--SGLFAKLVVHSTKIIVDEQGTTAGAVTEAALANKATPPKFLLN 423
            ..:|:.|:|.:..|:...:|  ..|.....:...||.|:|.||.|.:.|...::.:..|.:.:::
Human   314 ENLGMTDMFRQFQADFTSLSDQEPLHVAQALQKVKIEVNESGTVASSSTAVIVSARMAPEEIIMD 378

  Fly   424 RPFQYMIVEKATGLL 438
            |||.:::....||.|
Human   379 RPFLFVVRHNPTGPL 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 100/396 (25%)
SERPINE1NP_001373389.1 serpinE1_PAI-1 29..393 CDD:381007 103/417 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.