DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and Spn55B

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_524953.1 Gene:Spn55B / 49803 FlyBaseID:FBgn0028983 Length:374 Species:Drosophila melanogaster


Alignment Length:386 Identity:118/386 - (30%)
Similarity:185/386 - (47%) Gaps:30/386 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 DVLVSISQGVQDFALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRI- 130
            |..:..::|...|..:|.|.:|....|.|..|  ||||:.:.:.|.:.||:|||.:::.|:|.. 
  Fly     3 DFNLEFARGGARFTSELFQLLSAGGLKENVVF--SPFSIQTCIALAFAGSQGETADEIAKALHFV 65

  Fly   131 -NVEDEKLRGAYKVWSSFLNITTSTIEVATLQAIYTGKGYPIKNNYRDAI-QNYNVQPMEVDFYS 193
             |...|..:....|...:.|  ::.:.||  ..:|..:|..:|..|:.|| :.|:.:...::|..
  Fly    66 SNFPPEVAQTFQFVLEKYRN--SNLLRVA--NKLYVQEGKQLKPAYQSAIKEQYHSEAESINFAL 126

  Fly   194 PDSVIQ-INEDTNRTTRGLIPYTILPQDVY--GAKMFLLSSLYFKGQWKFPFNKTLTREEPFFSE 255
            .|:..| ||...|..|:|.|. .::..|.:  ..::.||::|:|||.|...|::..|.|:.|:..
  Fly   127 NDAAAQAINAWVNAKTQGKIT-ELVSADSFSDNTRLVLLNALHFKGSWAHKFSEERTEEDIFWVG 190

  Fly   256 SGEVIGKIPMMVQEANFAYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGFKLNDVANNLKALG 320
            ..|.: ||..|.|:|.|.| ...|.|....||:||...| |:|.|:||:....:..:|..||.:.
  Fly   191 EEEQV-KINYMNQKAKFNY-GFFEDLGCTALEMPYQDSD-LSMFVLLPQERTGIYALAEKLKTVN 252

  Fly   321 LRPILQRLAAFRNRASEDNEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENT--ANLDRMSSGL 383
            |..:..:|..        .||.|..|||.......|...|.|:||..:|.:..  :||.....|:
  Fly   253 LVDLADKLTV--------EEVHVKFPKFKVDYSLELAEKLKQLGITKMFTDQAEFSNLLESPEGV 309

  Fly   384 FAKLVVHSTKIIVDEQGTTAGAVTEAALANK--ATPPKFLLNRPFQYMIVEKATGLLLFAG 442
            |...|:|...|.|:|:||.|.|.|...:..:  ..|.:|..:|||.|:|..|..  :||||
  Fly   310 FVSKVLHKATIEVNEEGTEAAAATGMIMMTRMMTFPLQFQADRPFLYVIWNKKN--ILFAG 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 117/378 (31%)
Spn55BNP_524953.1 SERPIN 13..370 CDD:238101 116/376 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446345
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
54.950

Return to query results.
Submit another query.