DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and serpinb1

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001011419.1 Gene:serpinb1 / 496899 XenbaseID:XB-GENE-1217264 Length:377 Species:Xenopus tropicalis


Alignment Length:392 Identity:105/392 - (26%)
Similarity:192/392 - (48%) Gaps:32/392 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 SISQGVQDFALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRIN-VED 134
            ::|.....|:.||.::|:  ...|..:...||.|:.:.|.::..|:.|.|..|:.:.|..: |:|
 Frog     3 NLSSACTHFSFDLFRKIN--ENNATGNVFFSPISISTALAMVLLGARGNTAQQISRILHFDAVKD 65

  Fly   135 EKLRGAYKVWSSFL---NITTSTIEVATLQAIYTGKGYPIKNNYRDAI-QNYNVQPMEVDFYS-- 193
              |...::..::.:   |:::..:.:|  ..::..|.:....::..:: :.||.....|||.|  
 Frog    66 --LHSNFQTLNAEINKKNVSSYALNLA--NRLFGEKSFKFLPDFLSSVKKQYNADLGTVDFISAA 126

  Fly   194 PDSVIQINEDTNRTTRGLIPYTILPQDVYG-AKMFLLSSLYFKGQWKFPFNKTLTREEPF-FSES 256
            .|:..:||...:..|:|.||..:....|.. .|:.|::::||||.|...|....|::.|| .::.
 Frog   127 EDARKEINTWVSEQTKGKIPEVLSAGAVNSFTKLVLVNAIYFKGDWAKKFKAEHTKDMPFQLNKK 191

  Fly   257 GEVIGKIPMMVQEANFAYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGFKLNDVANNLKALGL 321
            .:...|:...:::..|.|:..:   :..|||||| ....|:|::|||.   .:||....|:.|..
 Frog   192 EQKTVKMMYQMEKLPFNYIPEI---NCRVLELPY-VDYELSMVIVLPD---NINDDTTGLQQLEK 249

  Fly   322 RPILQRLAAFRNRASEDN---EVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANLDRM--SS 381
            ...|:::    |..:|:.   :|.|.:|||.....:.||..|..||:.|||:..:|:|..|  |:
 Frog   250 ELSLEKI----NEWTENMMPIDVHVHLPKFKLEDSYKLKSQLAGMGMADLFEAGSADLSGMSGSN 310

  Fly   382 GLFAKLVVHSTKIIVDEQGTTAGAVTEA-ALANKATPPKFLLNRPFQYMIVEKATGLLLFAGQVR 445
            .|:...|:|.:.:.|:|:||.|.|.:.. |:.......:|..|.||.:.|...||..:||.|:..
 Frog   311 DLYLSEVIHKSFVEVNEEGTEAAAASAGIAMMCLMREEEFNANHPFLFFIRHNATKSILFFGRYS 375

  Fly   446 NP 447
            :|
 Frog   376 SP 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 103/383 (27%)
serpinb1NP_001011419.1 SERPIN 4..377 CDD:294093 104/389 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.