DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and serpinb1

DIOPT Version :10

Sequence 1:NP_649205.3 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001011419.1 Gene:serpinb1 / 496899 XenbaseID:XB-GENE-1217264 Length:377 Species:Xenopus tropicalis


Alignment Length:50 Identity:13/50 - (26%)
Similarity:22/50 - (44%) Gaps:11/50 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 TAAESVH-----FRLLCP---ATRTGAIIGKGGSVIRH---LQSVTGSKI 52
            |.:.::|     |...||   .:|.|..:..||..::.   :||:..|.|
 Frog    80 TQSSTIHDVKQKFHKACPKWYPSRVGLQLECGGPFLKDYITIQSIAASSI 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_649205.3 serpin77Ba-like_insects 72..447 CDD:381062
serpinb1NP_001011419.1 serpinB1_LEI 1..377 CDD:381028 12/49 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.