DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and serpinb1l1

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001009892.2 Gene:serpinb1l1 / 494155 ZFINID:ZDB-GENE-040715-5 Length:384 Species:Danio rerio


Alignment Length:393 Identity:113/393 - (28%)
Similarity:192/393 - (48%) Gaps:27/393 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 SISQGVQDFALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRINVED- 134
            |:|.....|:|:|.::||  ...|:.:...||.|:.|.|.::..|::|.|.:|:.|.|..|.:. 
Zfish     3 SLSAANTQFSLNLFKKIS--GGNASGNVFYSPVSISSALAMVSLGAKGNTADQMFKVLGFNSQAH 65

  Fly   135 ---EKLRGAYKVWSSFLNITTSTIEVATLQAIYTGKGYPIKNNY-RDAIQNYNVQPMEVDFY--S 193
               |::...:|.:.|.||...:...::....:|..:.|.:...: .|..:.|:....:|||.  |
Zfish    66 QPVEQIHSNFKKFMSELNKPEAPYVLSLANRLYGEQTYQLIEKFLNDTKRYYDAGLEKVDFINKS 130

  Fly   194 PDSVIQINEDTNRTTRGLIPYTILPQDVYGA--KMFLLSSLYFKGQWKFPFNKTLTREEPFFSES 256
            .|:.:.||....:.|:..|. .:||.....|  ::.|::::||||.|:..|.|..||:..|....
Zfish   131 EDARVNINTWVEKNTQEKIK-DLLPSGAIDAMTRLVLVNAIYFKGNWEEKFPKEATRDGVFRLNK 194

  Fly   257 GEVIGKIPMMVQEANF--AYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGFKLNDVANNLKAL 319
            .:. ..:.||.|:|.|  .|   :|.:..:||||||..:: |:|:::||.   ::.|....|:.|
Zfish   195 NQT-KPVKMMHQKAEFPSGY---IEEMKSHVLELPYAGKN-LSMLIILPD---EIEDETTGLQKL 251

  Fly   320 GLRPILQRLAAF-RNRASEDNEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANLDRMSSG- 382
            ......::|..: :.......||:|.:|||.|...:.:|.:|:.||:.|:||....||..|||. 
Zfish   252 ERALTYEKLMEWTKPEVMHQREVQVSLPKFKTEQTYDMKSLLVSMGMEDVFDPQKVNLTGMSSSN 316

  Fly   383 -LFAKLVVHSTKIIVDEQGTTAGAVTEA--ALANKATPPKFLLNRPFQYMIVEKATGLLLFAGQV 444
             |.....:|...:.|:|:||.|.|.|.|  .|.....|..|..:.||.:.|....|..:||.|::
Zfish   317 DLVLSKAIHKAFVEVNEEGTEAAAATAAIEKLMCYIPPLSFNADHPFLFFIRHNPTKSILFYGRL 381

  Fly   445 RNP 447
            .:|
Zfish   382 CSP 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 110/384 (29%)
serpinb1l1NP_001009892.2 PAI-2 4..384 CDD:239013 111/390 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.