DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and serpinc1

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001008153.1 Gene:serpinc1 / 493515 XenbaseID:XB-GENE-975782 Length:456 Species:Xenopus tropicalis


Alignment Length:471 Identity:122/471 - (25%)
Similarity:199/471 - (42%) Gaps:52/471 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LMLWIPLLLGAIFL-------CSADPQNNQAPLQLSVGNPLTAFTAPTAFQSGVSHIQSMRSNFD 65
            |.|.:..|||:.:|       |.|.|::............|.|..|....:......|.:..:.:
 Frog     4 LSLLLLSLLGSGYLQSQNADICLAKPKDIPLTPMCVYRKTLEAVEAEEKEKEPAQQEQKVPESTN 68

  Fly    66 TDVLVSISQGVQDFALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRI 130
            ..| ..:||....||:...:.::...:.....|| ||.|:.....:...|:...|..:|.:....
 Frog    69 PRV-YELSQANAKFAIAFYKNLADSKQNTENIFM-SPLSISQAFTMAKLGACNNTLKELMEVFYF 131

  Fly   131 NVEDEKLRGAYKVWSSFLNI-----TTSTIEVATLQAIYTGKGYPIKNNYRDAIQ-NYNVQPMEV 189
            :...|:.......:.:.||.     ...:.|:.::..::..|.......|:|..: .|..:.:.:
 Frog   132 DTISERASDQIHYFFAKLNCRLFRKANKSSELVSVNRLFGEKSLTFNETYQDISELVYGAKLLPL 196

  Fly   190 DFYSPDSVIQ------INEDTNRTTRGLIPYTILPQDVYGAKMFLLSSLYFKGQWKFPFNKTLTR 248
            :|.....:.:      :::.|.:....:||..::..|..   :.|::::||||.||..||...|:
 Frog   197 NFKEKPELSREIINNWVSDKTEKRITDVIPVGVITPDTV---LVLINAIYFKGLWKSKFNSENTK 258

  Fly   249 EEPFF-SESGEVIGKIPMMVQEANFAYVSNVEGLDG-YVLELPYGTQDRLAMIVVLPKRGFKLND 311
            .|.|: .||...:.  ..|.||..|.|.|..:  || .||||||...| :.|::|||.....|..
 Frog   259 MEQFYPDESNHCLA--ATMYQEGIFRYSSFKD--DGVQVLELPYKGDD-ITMVLVLPSPETPLMK 318

  Fly   312 VANNLKALGLRPILQRLAAFRNRASEDNEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANL 376
            |..||....|...||:        |.:.::.|.:|:|.....|::|..|.|||:.||||.|:|.|
 Frog   319 VEQNLTLEKLGNWLQK--------SRELQLSVYLPRFRVEDSFSVKEKLQQMGLVDLFDPNSAKL 375

  Fly   377 DRMSSG----LFAKLVVHSTKIIVDEQGTTAGAVTEAALA------NKATPPKFLLNRPFQYMIV 431
            ..:.:|    |:.....|...:.|:|:|:.|.|.|...|.      |:.|   |..||||...|.
 Frog   376 PGIVAGGRTDLYVSDAFHKAFLEVNEEGSEAAASTAVILTGRSLNLNRIT---FRANRPFLVFIR 437

  Fly   432 EKATGLLLFAGQVRNP 447
            |.|...:||.|:|.||
 Frog   438 EVAINSVLFMGRVANP 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 103/392 (26%)
serpinc1NP_001008153.1 serpinC1_AT3 61..455 CDD:381002 110/414 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.