DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and Spn88Eb

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster


Alignment Length:421 Identity:102/421 - (24%)
Similarity:186/421 - (44%) Gaps:76/421 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 ISQGVQDFALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRIN--VED 134
            |.:|.:||:|.|:::|.......|..|  ||||.::.|:|.|..|..:|..:|.::|.:.  :..
  Fly    34 IFKGERDFSLALMKQIREIYPSGNLFF--SPFSTYNALLLAYFSSSEQTERELAQALNLGWALNK 96

  Fly   135 EKLRGAYKV--------WSSFLNITTSTIEVATLQAIYTGKGYPIKNNYRDAIQNYNVQPMEVDF 191
            :::..:|.:        |..      |.:|:::...|:..:...:.|.:...:..   ...|:||
  Fly    97 QQVLVSYTLAQRQDEFRWRQ------SPMELSSANRIFVDRTINVSNKFNTLLYG---ATKELDF 152

  Fly   192 YS-PDSVIQ-----INEDTNRTTRGLI------PYTILPQDVYGAKMFLLSSLYFKGQWKFPFNK 244
            .: |::.::     |.:.|:...|.::      |:|:|         .|.::.|.||||...|..
  Fly   153 KNDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTML---------VLANAAYMKGQWLSQFKV 208

  Fly   245 TLTREEPFFSESGEVIGKIPMMVQEANFAYVSNVEGLDGYVLELPYGT--------------QDR 295
            ..|..:|||....|  .::..|:.:.....::..|||...:::|||.|              :..
  Fly   209 EETALKPFFINERE--QEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSD 271

  Fly   296 LAMIVVLPKRG-FKLNDVANNLKALGLRPILQRLAAFRNRASEDNEVEVMMPKFVTATDFTLKGV 359
            ::||::||... ..||.|.:.|.|..::...:|        :...::|:.:|||.......|..:
  Fly   272 ISMIIILPNSNKISLNRVISRLNADSVKKWFER--------ALPQKIELSLPKFQFEQRLELTPI 328

  Fly   360 LIQMGIRDLFDENTANLDRMSSGLFAKLVV----HSTKIIVDEQGTTAGAVTEAALANKA---TP 417
            |..||:..:|..|....|..:..:  .||:    |..||.|||.|:||.|.|...::..:   .|
  Fly   329 LSLMGVNTMFTRNATFGDLTADPI--SLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDP 391

  Fly   418 PKFLLNRPFQYMIVEKATGLLLFAGQVRNPK 448
            .||..|.||.::|.::....:||||...:|:
  Fly   392 TKFNCNHPFVFLIYDEKVDTILFAGVYSDPR 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 100/412 (24%)
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 100/412 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446250
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.