DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and Spn85F

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_649965.2 Gene:Spn85F / 41221 FlyBaseID:FBgn0037772 Length:640 Species:Drosophila melanogaster


Alignment Length:594 Identity:100/594 - (16%)
Similarity:176/594 - (29%) Gaps:251/594 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 DFALDLLQRISVEVEKANK-DFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRINVEDEKLRGAY 141
            |...||..|:.......|: :|..||.::.|:||.|:|||.|.|..:|:..|::....:..|..|
  Fly    68 DLTNDLTHRLLHYHSILNRNNFAFSPTALVSVLVALFEGSAGNTAEELRHVLQLPNNRDVTRVGY 132

  Fly   142 K----------------VWSSFLNITTSTI--EVATLQAIYTGKGYPIK---------NNYRDA- 178
            :                :....||....|:  :..|:...|   ||.:.         |...|| 
  Fly   133 RDIHRRLRTYFFGSDNPLKGLSLNKGNVTVLKDFETVLMFY---GYDLSVDMLSSTPANLTSDAE 194

  Fly   179 ----IQNYNVQPMEVDFYS----------------------------PDSVIQINEDTNRTTRG- 210
                ....|...||:|..:                            |.:..:...:|..||.. 
  Fly   195 LVNTTMASNTTTMEMDAETTTSKDAESTTEEPATTTTEPPATTTAEPPTTTTETPAETEATTEAP 259

  Fly   211 --------------------LIPYTILPQD------VYGAKMFLLSSLYFKGQWK---------- 239
                                |:...:..:|      :..|::..|.:...:...|          
  Fly   260 AATSGEEEAAEPAGEDEAAELVSAFVAEEDSEPLLRIQKARVSRLPTSKLQAPLKHSNPITPKPI 324

  Fly   240 -FPFNKTLTREEPFFSE---------SGEVIGKIPMMVQEAN----------------------- 271
             .|..:|:....|..:.         :.:||..|...||.||                       
  Fly   325 YLPSARTVAMPMPMMARQVAERKPPGTRQVISIIAPSVQPANISVTRKTKTARYKRHAIPAYKDL 389

  Fly   272 -----------------------------FAYVSN----------VEGLDGY------------- 284
                                         ||.::|          .||...|             
  Fly   390 DANLFLTLFNPHTHVPHHPLHFPPPVPAAFAPITNDFEPHYIGEAAEGKSNYNTDVISHVFYLGN 454

  Fly   285 --------------------------VLELPYGTQDRLAMIVVLPKRGFKLNDVANNLKALGLRP 323
                                      ||||...|.: ..::::||...   .|:.....:|.|.|
  Fly   455 QQVVHTTFKVYNAVLYYKYFEHLKMSVLELELDTPE-YNLMILLPDYH---TDIVAAAASLKLGP 515

  Fly   324 ILQRLAAFRNRASEDNEVEVMMPKFVTA--TDFTLKGVLI------QMGIRDLFDENTANLDRMS 380
            .|:.:.            :.:.|::|.|  .||.|.|.:.      .|||.|:|:.|.|:...|:
  Fly   516 TLRLMR------------KQLKPRWVQAIIPDFKLHGTMFLTNDLQNMGICDVFEPNRADFRPMT 568

  Fly   381 --SGLFAKLVVHSTKII-----VDEQGTTAGAVTEAALANKATPPKFLLNRPFQYMIVEKATGLL 438
              .|::.:.:..|..:.     :::.....||        ::.|.:..:|.||.:.||::...:.
  Fly   569 EEKGVYVRHIEQSIDVTIRTHPINQLKRNYGA--------QSKPIQISVNHPFLFFIVDRDLDVA 625

  Fly   439 LFAGQVRNP 447
            :.:|::.||
  Fly   626 VMSGRILNP 634

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 98/589 (17%)
Spn85FNP_649965.2 SERPIN 88..>204 CDD:294093 26/118 (22%)
SERPIN <450..634 CDD:294093 38/207 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.