DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and Serpinb3d

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_958764.1 Gene:Serpinb3d / 394252 MGIID:2683295 Length:387 Species:Mus musculus


Alignment Length:399 Identity:101/399 - (25%)
Similarity:186/399 - (46%) Gaps:52/399 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 FALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRINV----------- 132
            |.|:|.:    ::.:::.:...||.|:...|.:|..|::..|..|:||.|..|.           
Mouse    11 FTLELYR----QLRESDNNIFYSPISMMRTLAMLLLGAKANTEQQIKKVLHFNETTKKTTEKSAE 71

  Fly   133 --EDEKLRGAYKVWSSFLNITTSTIEVATLQAIYTGKGYPIKNNYRDAIQNY---NVQPMEVDFY 192
              ::|.:...:::..:.||...:..::....:||..|.:|....:...|:.|   ||:.::....
Mouse    72 SHDEENVHQQFQMLMTQLNKFNNAYDLKVPNSIYGAKDFPFLQTFLKDIRKYYQANVESLDFAHA 136

  Fly   193 SPDSVIQINEDTNRTTRGLIPYTILPQDVYGAK--MFLLSSLYFKGQWKFPFNKTLTREEPFFSE 255
            :.:|..:||....|.|.|.|. .:.|.....:.  :.|::::||||||...|::..||||.|:..
Mouse   137 AEESQKKINSWMARQTNGKIK-DLFPSGSLNSSTILVLVNAVYFKGQWNHKFDEKHTREEKFWLN 200

  Fly   256 SGEVIGKIPMMVQ--EANFAYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGFKLNDVANNLKA 318
            . .....:.||.|  :.||.::.||:   ..::|:||..:: |:|.|:||            ::.
Mouse   201 K-NTSKPVQMMKQRNKFNFIFLENVQ---AKIVEIPYKGKE-LSMFVLLP------------VEI 248

  Fly   319 LGLRPILQRLAAFR----NRASEDN--EVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANLD 377
            .||:...::|.|.:    .||...:  |:.:.:|:|.....:.|:..|..||:.|.||...|:..
Mouse   249 DGLKKFEEQLTADKLLQWTRAENMHMTELYLSLPQFKVEEKYDLRVPLEHMGMVDAFDPQKADFS 313

  Fly   378 RMSS--GLFAKLVVHSTKIIVDEQGTTAGAV--TEAALANKATPPKFLLNRPFQYMIVEKATGLL 438
            .||:  ||....|:|.:.:.|:|:|..|...  .|:...:...|..|..|.||.:::.:..|..:
Mouse   314 GMSNSQGLVVSKVLHKSFVEVNEEGAEAATAMSVESRSLSVPKPNDFSCNHPFLFVMKQNKTNSI 378

  Fly   439 LFAGQVRNP 447
            ||.|:|.:|
Mouse   379 LFFGRVSSP 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 99/394 (25%)
Serpinb3dNP_958764.1 SERPIN 7..387 CDD:294093 100/397 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.