DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and Serpinb3b

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_941373.1 Gene:Serpinb3b / 383548 MGIID:2683293 Length:387 Species:Mus musculus


Alignment Length:402 Identity:101/402 - (25%)
Similarity:191/402 - (47%) Gaps:58/402 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 FALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRINVE---------- 133
            ||:::.:    ::.:::|:...||.|:.:.|.:|..|::|.|..|::|.|:. :|          
Mouse    11 FAVEMYR----QLRESDKNIFYSPISMMTALAMLQLGAKGNTEIQIEKVLQF-IETTKKTTEKSE 70

  Fly   134 ----DEKLRGAYKVWSSFLNITTSTIEVATLQAIYTGKGYPIKNNYRDAIQNY---NVQPMEVDF 191
                :|.:...::...:.||.:....::....:||..||:|....:.:.|:.|   .|:.::.:.
Mouse    71 HCDDEENVHEQFQKLITQLNKSNDDYDLKAANSIYGAKGFPFLQTFLEDIKEYYQAKVESLDFEH 135

  Fly   192 YSPDSVIQIN----EDTNRTTRGLIPYTILPQDVYGAKMFLLSSLYFKGQWKFPFNKTLTREEPF 252
            .:.:|..:||    ..||...:.|.|...|.....   :.|::::||||||...||:..||||.|
Mouse   136 ATEESEKKINSWVESKTNGKIKDLFPSGSLSSSTI---LVLVNAVYFKGQWNRKFNENHTREEKF 197

  Fly   253 FSESGEVIGKIPMMVQ--EANFAYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGFKLNDVANN 315
            :... .....:.||.|  :.||:::.:|.   ..::|:||..:| |:|.|:||            
Mouse   198 WLNK-NTSKPVQMMKQRNKFNFSFLGDVH---AQIVEIPYKGKD-LSMFVLLP------------ 245

  Fly   316 LKALGLRPILQRLAA------FRNRASEDNEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTA 374
            ::..||:.:.::|..      .:.......|:.:.:|:|.....:.|:..|..||:.|.||...|
Mouse   246 MEIDGLKQLEEQLTTDKLLEWIKAENMHLTELYLSLPRFKVEEKYDLQVPLEHMGMVDAFDPQKA 310

  Fly   375 NLDRMSS--GLFAKLVVHSTKIIVDEQGTTAGAVT--EAALANKATPPKFLLNRPFQYMIVEKAT 435
            :...|||  ||....|:|.:.:.|:|:||.|.|.|  |.::.:......|..:.||.:.|:.:.|
Mouse   311 DFSGMSSIPGLVVSKVLHKSFVEVNEEGTEAAAATGVEVSVRSAQIAEDFCCDHPFLFFIIHRMT 375

  Fly   436 GLLLFAGQVRNP 447
            ..:||.|::.:|
Mouse   376 NSILFFGRICSP 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 100/397 (25%)
Serpinb3bNP_941373.1 SERPIN 6..387 CDD:294093 100/400 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.