DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and Serpinb3c

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_958751.2 Gene:Serpinb3c / 381286 MGIID:1277952 Length:386 Species:Mus musculus


Alignment Length:387 Identity:105/387 - (27%)
Similarity:188/387 - (48%) Gaps:47/387 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 EVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRINVEDEKL--RGAY-----KVWSSF 147
            ::.:::|:...||.|:.:.|.:|..|::|.|..|::|.|:.|...||.  :.|:     .|...|
Mouse    18 QLRESDKNIFYSPISMITALGMLKLGAKGNTEIQIEKVLQCNETTEKTTEKSAHCDDEDNVHEQF 82

  Fly   148 ------LNITTSTIEVATLQAIYTGKGYPIKNNYRDAIQNY---NVQPMEVDFYSPDSVIQIN-- 201
                  ||.:....::....:||..||:|:...:.:.|:.|   ||:.::.:..:.:|..:||  
Mouse    83 QKLITQLNKSNDDYDLKAANSIYGAKGFPLLQTFLEDIKEYYHANVESLDFEHAAEESEKKINFW 147

  Fly   202 --EDTNRTTRGLIPYTILPQDVYGAKMFLLSSLYFKGQWKFPFNKTLTREEPFFSESGEVIGKIP 264
              .:||...:.|.|...|..   ..|:.|::::||||:|...|::..|.||.|:......| .:|
Mouse   148 VKNETNGKIKDLFPSGSLSS---STKLVLVNAVYFKGRWNHKFDENNTIEEMFWLNKNTSI-PVP 208

  Fly   265 MMVQEANFAYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGFKLNDVANNLKALGLRPILQRLA 329
            ||.|...|.: |.:|.:...::|:||..:: |:|.|:||            ::..||:.:.::|.
Mouse   209 MMKQRNKFMF-SFLEDVQAQIVEIPYKGKE-LSMFVLLP------------MEIDGLKQLEKQLT 259

  Fly   330 AFR----NRASEDN--EVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANLDRMSS--GLFAK 386
            |.:    .||...:  |:.:.:|:|.....:.|...|..||:.:.||...|:...|||  ||...
Mouse   260 AAKLLEWTRAENMHLTELYLWLPRFKVEEKYDLPVPLECMGMVNAFDPQKADFSGMSSTQGLVVS 324

  Fly   387 LVVHSTKIIVDEQGTTAG-AVTEAALANKATPPKFLLNRPFQYMIVEKATGLLLFAGQVRNP 447
            .|:|.:.:.|:|:||.|. |..|..:...|....|..:.||.:.|:...|..:||.|::.:|
Mouse   325 KVLHKSFVEVNEEGTEADPASGEEVILRLAQVADFRCDHPFLFFIIHSKTNSILFFGRISSP 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 104/382 (27%)
Serpinb3cNP_958751.2 SERPIN 6..386 CDD:294093 104/385 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.