DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and Serpinb1c

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_006516771.1 Gene:Serpinb1c / 380839 MGIID:2445363 Length:408 Species:Mus musculus


Alignment Length:444 Identity:122/444 - (27%)
Similarity:198/444 - (44%) Gaps:71/444 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 SVGNPLTAFTAPTAFQSGVSHIQSMRSNFDTDVLVSISQGVQD-----FALDLLQRISVEVEKAN 95
            :.||.|...        ||..:..:..|.|...:.:.:.|...     |||:|...::......|
Mouse     4 NTGNQLQVL--------GVGGLADIVGNVDPPSVAAFTMGQLSSANNLFALELFHTLNESNPTGN 60

  Fly    96 KDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRINVEDEKLRGAYKVWSSFLNIT--------T 152
            ..|  ||.|:.|.|.::|.|:.|.|..||.|:|..:       .|..:.|.|.::|        :
Mouse    61 TIF--SPVSISSALAMVYLGARGSTAAQLSKTLHFD-------SAEDIHSQFQSLTAEVSKRGAS 116

  Fly   153 STIEVATLQAIYTGKGYPIKNNYRDAIQ-NYNVQPMEVDFY--SPDSVIQINEDTNRTTRGLIPY 214
            .|:::|  ..:|..|.|.....|..:|| .|:.....|||.  |.|:..:||:.....|...|  
Mouse   117 HTLKLA--NRLYGEKTYNFLPEYLASIQKTYSADLALVDFQHASEDARKEINQWVKGQTEEKI-- 177

  Fly   215 TILPQDVYG-------AKMFLLSSLYFKGQWKFPFNKTLTREEPFFSESGEVIGKIPMMVQEAN- 271
                |:::.       .|:.|:::.||||.|:..|....|.:.| |..|.:|...:.||..:.| 
Mouse   178 ----QELFAVGVVDSMTKLVLVNATYFKGMWQKKFMARDTTDAP-FRLSKKVTKTVKMMYLKNNL 237

  Fly   272 -FAYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGFKLNDVANNLKALGLRPILQRLAAFRNRA 335
             |.|:.:   |...|||:|| ....|:|:::||:   .:.|....|:.:..:..|::|....|..
Mouse   238 PFGYIPD---LKCKVLEMPY-QGGELSMVILLPE---DIEDETTGLEEIEKQLTLEKLQECENLQ 295

  Fly   336 SEDNEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANLDRMSSG--LFAKLVVHSTKIIVDE 398
            :.|  |.|.:|||.....:.|...|.|:|::|||..:.|:|..||..  ||...:||.:.:.|:|
Mouse   296 NID--VCVKLPKFKMEESYILNSNLGQLGVQDLFSSSKADLSGMSGSRDLFISKIVHKSYVEVNE 358

  Fly   399 QGTTAGAVTEAALANKAT-----PPKFLLNRPFQYMIVEKATGLLLFAGQVRNP 447
            :||.    |:||:.....     |.:|.::.||.:.|....|..:||.|:|.:|
Mouse   359 EGTE----TDAAMPGTVVGCCLMPMEFTVDHPFLFFIRHNPTAHVLFLGRVCSP 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 113/400 (28%)
Serpinb1cXP_006516771.1 serpinB1_LEI 34..408 CDD:381028 114/404 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.