DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and AT1G62160

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_176407.2 Gene:AT1G62160 / 3767608 AraportID:AT1G62160 Length:220 Species:Arabidopsis thaliana


Alignment Length:238 Identity:63/238 - (26%)
Similarity:94/238 - (39%) Gaps:45/238 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 KMFLLSSLYFKGQWKFPFNKTLTR-EEPFFSESGEVIGKIPMMVQEANF--AYVSNVEGLDGYVL 286
            :.|:||  :.|.......|..|.: ....|.:..:..|  |.|....||  .|::..:|..  ||
plant    15 RFFILS--FLKASSTDELNAVLRKIASSVFVDGSKKGG--PKMRGHKNFEKQYIAAYDGFK--VL 73

  Fly   287 ELPY-----GTQDRLAMIVVLPKRGFKLNDVANNLKALGLRPILQRLAAFRNRASEDNEVEVMMP 346
            .|||     .|....:|...||.:..:|:|:   ||.:...|........|.|...|   |..:|
plant    74 RLPYRQGRDNTNRNFSMYFYLPDKKGELDDL---LKRMTSTPGFLDSHTPRERVEVD---EFRIP 132

  Fly   347 KFVTATDFTLKGVLIQMGIRDLFDENTANLDRMSSGLFAKLVVHSTKIIVDEQGTTAGAVTEAAL 411
            ||.....|....|.....|...|              :.|.::.     :||:||.|.|.| |.:
plant   133 KFKIEFGFEASSVFSDFEIDVSF--------------YQKALIE-----IDEEGTEAAAAT-AFV 177

  Fly   412 ANK-----ATPPKFLLNRPFQYMIVEKATGLLLFAGQVRNPKA 449
            .|:     .....|:.:.||.::|.|:.||.:|||||:.:|.|
plant   178 DNEDGCGFVETLDFVADHPFLFLIREEQTGTVLFAGQIFDPSA 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 60/231 (26%)
AT1G62160NP_176407.2 SERPIN <43..218 CDD:294093 54/204 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.