DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and Serpinb6b

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_038951899.1 Gene:Serpinb6b / 364705 RGDID:1310452 Length:388 Species:Rattus norvegicus


Alignment Length:402 Identity:110/402 - (27%)
Similarity:194/402 - (48%) Gaps:57/402 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 FALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRINVEDEKL--RGAY 141
            ||.:||:.:.   |.::|:.:.||.|:.|.|.:::.|::|.|.:|:.::|.:    :|.  ||:.
  Rat    11 FAFNLLKTLG---EDSSKNVLFSPLSISSGLAMVFMGAKGTTAHQMIQALSL----DKCSGRGSR 68

  Fly   142 KVWSSF------LNITTSTIEVATLQAIYTGKGYPIKNNYRDAIQN-YNVQPMEVDFY-SPDSVI 198
            .|...|      :|.|.:...:.|...::..|.:.|..:::||.:. |..:..|:||. :|:...
  Rat    69 DVHQGFQSLLAKVNKTGTQYLLKTANRLFGEKTFDILASFKDACRKFYEAEMEELDFKGAPEQSR 133

  Fly   199 Q-INEDTNRTTRGLIPYTILPQDV--------------------YGAKMFLLSSLYFKGQWKFPF 242
            | ||....:.|.|        |.:                    ....:.|::::||||.||..|
  Rat   134 QHINTWVAKKTEG--------QSISLNWNSQKKITELLSSGSVNANTPLVLVNAIYFKGNWKKQF 190

  Fly   243 NKTLTREEPFFSESGEVIGKIPMMVQEANFAYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGF 307
            ||..|:|.||.....|. ..:.||.:::.|. ::.||.:...:|.||| ..:.|.||::||....
  Rat   191 NKEDTQEMPFKVTKNEE-KPVKMMFKKSTFK-MTYVEEISTTILLLPY-VGNELNMIIMLPDEHI 252

  Fly   308 KLNDVANNLKALGLRPILQRLAAFRNRASEDNEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDEN 372
            :|..|.   |.:..:..::..:..:   .|:.||||.:|||....:..:|.||.::|:.|.|::.
  Rat   253 ELRMVE---KEITYKKFIEWTSLDK---MEEREVEVFLPKFKLEENHDMKDVLHRLGMTDAFEQG 311

  Fly   373 TANLDRMSS--GLFAKLVVHSTKIIVDEQGTTAGAVTEAALANKATPPKFLLNRPFQYMIVEKAT 435
            .|:...::|  |||...|:|.:.:.|:|:||.|.|.|.|.:..:...|.|..|.||.:.|....|
  Rat   312 MADFSGIASKEGLFLSKVIHKSFVEVNEEGTEAAAATAANVTFRCMVPYFCANHPFLFFIQHSRT 376

  Fly   436 GLLLFAGQVRNP 447
            ..::|.|:..:|
  Rat   377 NGIVFCGRFSSP 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 109/397 (27%)
Serpinb6bXP_038951899.1 serpin 1..388 CDD:422956 109/400 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.