DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and Serpinb9

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_006253934.1 Gene:Serpinb9 / 361241 RGDID:1549730 Length:396 Species:Rattus norvegicus


Alignment Length:392 Identity:111/392 - (28%)
Similarity:194/392 - (49%) Gaps:29/392 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 VLVSISQGVQDFALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRINV 132
            ::.::|:....||:.||:.:.  ....:::...||.|:.|.|.::..|::|:|:.|:.::|.:|.
  Rat    22 IMNTLSEANGTFAIHLLKMLC--QSNPSENVCYSPVSISSALAMVLLGAKGQTQVQISQALGLNK 84

  Fly   133 EDEKLRGAYKVWSSFLNITTSTIEVATLQAIYTGKGYPIKNNYRDA-IQNYNVQPMEVDF--YSP 194
            |.: |...:::..|.||.......:.....::..|...:...|::: ::.||.:..::.|  .:.
  Rat    85 EKD-LHQGFQLLLSNLNKPERKYSLRVANRLFADKTCELLPTYKESCLRFYNSEMEQLSFAEAAE 148

  Fly   195 DSVIQINEDTNRTTRGLIPYTILPQDVYG-AKMFLLSSLYFKGQWKFPFNKTLTREEPFFSESGE 258
            :|...||...::.|.|.||..:....|.. .::.|:::|||||:|..||||..|.:.||.....|
  Rat   149 ESRKHINTWVSKQTEGKIPELLSGGSVDSETRLVLVNALYFKGRWHQPFNKEYTVDMPFKINKNE 213

  Fly   259 VIGKIPMMVQE--ANFAYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGFKLNDVANNLKALGL 321
            . ..:.||..|  .|.|:|..|:   ..||.:||...: |:.:|:||.....|:.|.:||     
  Rat   214 K-RLVQMMCCEDTYNLAHVKEVQ---AQVLMMPYEGME-LSFVVLLPDNDGDLSKVESNL----- 268

  Fly   322 RPILQRLAAFRN-RASEDNEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANLDRMS--SGL 383
              ..::|.|:.| ...::..|||.:|||....|:.::.|..::||.|:|.|..|:|..||  ..|
  Rat   269 --TFEKLTAWTNPDFMKNTNVEVFLPKFKLQEDYDMESVFQRLGIVDVFQEAKADLSAMSPERNL 331

  Fly   384 FAKLVVHSTKIIVDEQGT---TAGAVTEAALANKATPPKFLLNRPFQYMIVEKATGLLLFAGQVR 445
            ....:||.:.:.|:|:||   .|.||.|...|  |..|.|..:.||.:.|....|..:||.|:..
  Rat   332 CVSKIVHKSLVEVNEEGTEAAAASAVIEYCCA--AFVPTFCADHPFLFFIKHNKTNSILFCGRFS 394

  Fly   446 NP 447
            :|
  Rat   395 SP 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 109/380 (29%)
Serpinb9XP_006253934.1 SERPIN 26..396 CDD:294093 110/386 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.