DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and Spn43Ad

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster


Alignment Length:393 Identity:93/393 - (23%)
Similarity:164/393 - (41%) Gaps:54/393 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 FALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRI-NVEDEKLRGAYK 142
            |.|.|..::.:....||  .::||..:.:.|.|||..|..|..:||:::|.: :....||  |.:
  Fly    39 FGLRLTTKLGLTQPDAN--VVVSPLLIQAALSLLYAESSSEYGSQLRQALELTHASHPKL--AVQ 99

  Fly   143 VWSSFLNITTSTIEVA----TLQAIYTGKGYPIKNNYRDAIQNYNVQPMEVDFY--SPDSVIQIN 201
            .:.:.|.....:..:.    .|..:|..:.:..  |:|:..:....: |.|..:  |.:|.....
  Fly   100 DFETLLTDLKQSAAIGCRLRLLSDLYAQQRFTF--NFRNEFETLAAR-MGVGCHRLSWESASNAA 161

  Fly   202 EDTN-----RTTRGLIPYTILPQ----DVYGAKMFLLSSLYFKGQWKFPFNKTLTREEPFFSESG 257
            :|.|     |:...|......||    ..:......:|.:.|:..|.:.|:.|.|:...||:.  
  Fly   162 QDINYAFLSRSNFSLGELVSAPQLESLAEHNTPFLHVSGVTFRAPWAWAFDPTETQSINFFAG-- 224

  Fly   258 EVIGKIPMMVQ----EANFAYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGFKLNDVANNLKA 318
               |..|.:|.    :..:.| :.|..||..::|:|:.|.| |.|::|.|.|...|..:...|..
  Fly   225 ---GNRPRLVDAMFGQHRYRY-AEVPALDAQLIEVPFATAD-LRMLIVFPNRPDGLAQLERKLAQ 284

  Fly   319 LGLRPILQRLAAFRNRASEDNEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANLDRMSSGL 383
            ..|..:..:|        |:.:|.:.:||........||.||.::|:..|| .:..:|..:.|.:
  Fly   285 SDLHQLRSQL--------EERKVALTLPKLRVLVHSDLKHVLEELGLAKLF-TSEVHLSEVFSSI 340

  Fly   384 FAK------LVVHSTKIIVDEQGTTA-GAVTEAALANKATPPKFLLNRPFQYMIVEKATGLLLFA 441
            .:.      .||.|..:.:.|.|..| .:.:...|..:|.|  .::|.||.|.|....|  ||.:
  Fly   341 LSSSAPPLGAVVQSGLLELQEDGGNADDSFSFGDLFRRALP--LVINHPFFYAIGNGKT--LLLS 401

  Fly   442 GQV 444
            |.:
  Fly   402 GHI 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 93/391 (24%)
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 93/391 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446341
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.