DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and Spn28B

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster


Alignment Length:371 Identity:97/371 - (26%)
Similarity:172/371 - (46%) Gaps:35/371 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 EKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRINVEDEKLRGAYKVWSSFLNITTSTIE 156
            :.|.::.:.||.|...::.::|..|.|:|..:|:..|:.:.....:...|:...|.|....:.|.
  Fly    28 QNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSENKTLVANNYRSLLSDLKRRETFII 92

  Fly   157 VATLQAIYTGKGYPIKNNYRD-AIQNYNVQPMEVDFYSPDSVIQI-NEDTNRTTRGLIPYTILPQ 219
            :.....||..|.|.:...:.. |.:.:..:...:....|.|...| |......|||:|...:||:
  Fly    93 LHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSASAIVNSWILNRTRGMIRNIVLPK 157

  Fly   220 DVYG-AKMFLLSSLYFKGQWKFPFNKTLTREEPFFSESGEVIGKIPMMVQEANF--AYVSNVEGL 281
            |... ...||::::||||||.:.|....|....|:..:.|:| .:.||...|:.  .|:.::   
  Fly   158 DFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEII-PVKMMTLSASLLSGYIDDI--- 218

  Fly   282 DGYVLELPYGTQDRLAMIVVLPKRGFKLNDVANNLKALGLRPILQRLAAFRNRASEDNEVEVMMP 346
            |..::|||| ....|:|.::||      |.|.      |||.:.::: .|.:...|...|.|.:|
  Fly   219 DAKIIELPY-WNSTLSMRIILP------NSVD------GLRKLKEKV-GFIDYHLEKKSVNVKLP 269

  Fly   347 KFVTATDFTLKGVLIQMGIRDLFDENTANLDR--MSSGLFAKLVVHSTKIIVDEQGTTAGAVT-- 407
            ||...:...|||:...:||.|:| :.:|:|:.  :.||.....:|....:.:||:|..|.|.|  
  Fly   270 KFKIESKAQLKGIFENLGILDVF-KPSADLNGLVLESGAKIDKIVQKAFLKIDEKGGEASAATGV 333

  Fly   408 ----EAALANKATPP-KFLLNRPFQYMIVEKATGLLLFAGQVRNPK 448
                :.::.|...|| :|:.:.||.|:|.:..  ::.|.|.:..|:
  Fly   334 LTRRKKSIDNLIQPPMEFIADHPFFYVIHDNK--VIYFQGHIVEPR 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 96/365 (26%)
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 96/365 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446310
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
54.950

Return to query results.
Submit another query.