DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and serpinb1l4

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_956235.2 Gene:serpinb1l4 / 335229 ZFINID:ZDB-GENE-030131-7169 Length:433 Species:Danio rerio


Alignment Length:445 Identity:111/445 - (24%)
Similarity:190/445 - (42%) Gaps:82/445 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 SISQGVQDFALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRIN---- 131
            |:|.....|:|:|.::||  ...|:.:...||.|:.|.|.::..|::|.|.:|:.|.|..|    
Zfish     3 SLSAANTQFSLNLFKKIS--GGNASGNVFYSPVSISSALAMVSLGAKGNTADQMFKVLGFNNPPK 65

  Fly   132 -----------------------------------------------------VEDEKLRGAYKV 143
                                                                 ..:|::..::..
Zfish    66 PGGATPTPAQATQKPKWTCGVKSQHEPQALQQPQKFELPADLKKCPAQPVPGQKAEEQIHSSFNK 130

  Fly   144 WSSFLNITTSTIEVATLQAIYTGKGYPIKNNYRDAIQNYNVQPME-VDF--YSPDSVIQINEDTN 205
            ..|.||...:...::....:|..:.|.....|....:.|....:| |||  .|..|.:.||:...
Zfish   131 LMSELNKPGAPYVLSLANRLYGEQTYQFLEKYLSDAKKYYAAGLEKVDFKNKSEASCVNINKWVE 195

  Fly   206 RTTRGLIPYTILPQDVYGA--KMFLLSSLYFKGQWKFPFNKTLTREEPFFSESGEVIGKIPMMVQ 268
            :.|:..|. .:||.....|  ::.|::::||||.|:..|.|..|::..|.....:. ..:.||.|
Zfish   196 KNTQEKIK-DLLPSGAIDAMTRLVLVNAIYFKGNWEKKFPKEATKDGQFKLNKNQT-KPVKMMHQ 258

  Fly   269 EANFAYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGFKLNDVANNL----KALGLRPILQRLA 329
            :|.|.:|. :..::..:||||| ....|:|:::||.   ::.|....|    :||....::|...
Zfish   259 KAQFPFVV-IPEINSQILELPY-VGKNLSMLIILPD---EIEDATTGLQKLERALTYEKLMQWTK 318

  Fly   330 AFRNRASEDNEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANLDRMSSG--LFAKLVVHST 392
            ..|.:     ||:|.:|||.|...:.:|.:|:.||:.|:||....||..|||.  |....|:|..
Zfish   319 VMRQQ-----EVQVSLPKFKTEQTYDMKSLLVSMGMEDVFDPQKVNLTGMSSSNDLVLSKVIHKA 378

  Fly   393 KIIVDEQGTTAGAVTEAALANKATPPKFLLNRPFQYMIVEKATGLLLFAGQVRNP 447
            .:.|:|:||.|.|.|.|.::.:.....|..:.||.:.|...:|..:||.|:..:|
Zfish   379 FVEVNEEGTEAAAATGAVVSIRTLAQIFNADHPFLFFIRHNSTNTILFYGRFCSP 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 108/436 (25%)
serpinb1l4NP_956235.2 SERPIN 4..433 CDD:294093 109/442 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.