DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and SERPINA9

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_783866.3 Gene:SERPINA9 / 327657 HGNCID:15995 Length:417 Species:Homo sapiens


Alignment Length:447 Identity:123/447 - (27%)
Similarity:211/447 - (47%) Gaps:54/447 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLGAIFLCSADPQNNQAPLQ-LSVGNPLTAFTAPTAFQS-GVSHIQSMRSNFDTDVLVSISQGVQ 77
            :|.|:.||        ||:. :|..|..:|:..|::.:| ..|.:.|:.:               
Human     8 VLFAVGLC--------APIYCVSPANAPSAYPRPSSTKSTPASQVYSLNT--------------- 49

  Fly    78 DFALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRINVEDEKLRGAYK 142
            |||..|.:|:.:|....|  ...||.||.:.|.:|..|:...|:.|:.:.|..|:........::
Human    50 DFAFRLYRRLVLETPSQN--IFFSPVSVSTSLAMLSLGAHSVTKTQILQGLGFNLTHTPESAIHQ 112

  Fly   143 VWSSFLNITTSTIEVATLQ---AIYTGKGYPIKNNYRDAIQN-YNVQPMEVDFYSPDSVIQ--IN 201
            .:...::..|...:..||:   |::..|...::.|:...::. |..:....||.:| |:.|  ||
Human   113 GFQHLVHSLTVPSKDLTLKMGSALFVKKELQLQANFLGNVKRLYEAEVFSTDFSNP-SIAQARIN 176

  Fly   202 EDTNRTTRGLIPYTILPQDVYGAKMFLLSSLYFKGQWKFPFNKTLTREEPFFSESGEVIGKIPMM 266
            ....:.|:|.:...|...|:..| |.|::.::||.:|:.||:...||:...|....:|...:|||
Human   177 SHVKKKTQGKVVDIIQGLDLLTA-MVLVNHIFFKAKWEKPFHPEYTRKNFPFLVGEQVTVHVPMM 240

  Fly   267 VQEANFAYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGFKLNDVANNLKALGLRPILQRLAAF 331
            .|:..||:..:.| |:.:||::.| ..|.:|.. |||.:| |:..:...|.|..||.....|   
Human   241 HQKEQFAFGVDTE-LNCFVLQMDY-KGDAVAFF-VLPSKG-KMRQLEQALSARTLRKWSHSL--- 298

  Fly   332 RNRASEDNEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENT--ANLDRMSSGLFAKLVVHSTKI 394
                 :...:||.:|:|..:..:.|:.:|.:|||:::||:|.  :.:.:..| |......|...:
Human   299 -----QKRWIEVFIPRFSISASYNLETILPKMGIQNVFDKNADFSGIAKRDS-LQVSKATHKAVL 357

  Fly   395 IVDEQGT--TAGAVTEAALANKATPPKFLL--NRPFQYMIVEKATGLLLFAGQVRNP 447
            .|.|:||  ||...|:..:.:|..|..|.:  ||.|..||..|||..:||.|:|.||
Human   358 DVSEEGTEATAATTTKFIVRSKDGPSYFTVSFNRTFLMMITNKATDGILFLGKVENP 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 107/380 (28%)
SERPINA9NP_783866.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.