DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and Serpine3

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_017171543.1 Gene:Serpine3 / 319433 MGIID:2442020 Length:404 Species:Mus musculus


Alignment Length:388 Identity:106/388 - (27%)
Similarity:185/388 - (47%) Gaps:46/388 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 ISQGV----QDFALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRINV 132
            :|:|:    .:|||.|.:  |...|:...:|:|||.||...|.:|..|:.|.|..||..:|...|
Mouse    24 LSEGLWLLKTEFALHLYR--SAAAERNGTNFVISPASVSLSLEILQFGARGNTGWQLAGALGYTV 86

  Fly   133 EDEKLRGAYKVWSSFLNITTST---------IEVATLQAIYTGKGYPIKNNYRDAIQNYNVQPME 188
            :|.:::       .||:...:|         :|:|....:.||..  :...:.:.:..:....:|
Mouse    87 QDPRVK-------EFLHAVYTTRHNSSQGVGMELACTLFMQTGTS--LSPCFVEQVSRWANSSLE 142

  Fly   189 -VDFYSPDS-VIQINEDTNRTTRGLIPYTIL--PQDVYGAKMFLLSSLYFKGQWKFPFNKTLTRE 249
             .||..|:| ..:.::.|:|.:.|..|.:.|  ..|....::.::|::.|:..|:..|:..| :.
Mouse   143 AADFSEPNSTTTEASKVTSRQSTGEGPDSPLWGRADALSTQLSIMSTMTFQSTWQKRFSVVL-QP 206

  Fly   250 EPFFSESGEVIGKIPMM--VQEANFAYVSNVEGLDGYVLELPYGTQDRLA-MIVVLPK-RGFKLN 310
            .||....|.|: ::|.|  |.|.::....:..|.:..||||.|  ..|:| :::|||: :|..|:
Mouse   207 LPFTHAHGLVL-QVPAMHQVAEVSYGQFQDAAGHEIAVLELLY--LGRVASLLLVLPQDKGTPLD 268

  Fly   311 DVANNLKALGLRPILQRLAAFRNRASEDNEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTAN 375
            .:..:|.|..|.....||...|        ::|.:|:|.....|.:|.:|...||.||||...||
Mouse   269 HIEPHLTARVLHLWTTRLKRAR--------MDVFLPRFKIQNQFDVKSILRSWGITDLFDPLKAN 325

  Fly   376 LDRMS--SGLFAKLVVHSTKIIVDEQGTTAGAVTEAALANKATPPKFLLNRPFQYMIVEKATG 436
            |..:|  .|.:...:.|..|:.:.|:||.:.|.|...|..::....|..:|||.:::.|.:||
Mouse   326 LKGISGQDGFYVSQLTHKAKMELSEEGTRSSAATAVLLLRRSRTSAFKADRPFIFLLREHSTG 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 105/385 (27%)
Serpine3XP_017171543.1 serpin 20..388 CDD:393296 104/386 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.