DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and Spn75F

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001036614.1 Gene:Spn75F / 317912 FlyBaseID:FBgn0052203 Length:356 Species:Drosophila melanogaster


Alignment Length:341 Identity:68/341 - (19%)
Similarity:131/341 - (38%) Gaps:75/341 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 NFDTDVLVSISQGVQDFALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKS 127
            ||:.::...:|:|                 :..::|:.||.::...|.|||...:..|..||:.:
  Fly    21 NFEINLTKQLSKG-----------------RLARNFVYSPIAIRQALGLLYLSKDNVTDQQLESA 68

  Fly   128 LRI-NVEDEKLRGAYKVWSSFLNITTSTIEVATLQ-----AIYTGKGYPIKNNYRDAIQNYNVQP 186
            |:: .:..|::...:|         .:..:||..|     .||....|....|.....:|..|:.
  Fly    69 LQLTGLNQEEIISLFK---------EAREKVAQEQFTMGNRIYLSPDYNASPNITQLSENLGVEV 124

  Fly   187 MEVDFYSPDSVIQ-----INEDTNRTTRGLIPYTILPQDVYGAKMFLLSSLYFKGQWK----FPF 242
            ..:.|....|...     :|:...:....|.....:.|.   .::..:..:.:...||    ...
  Fly   125 KNMTFSGDQSAASEIKKWLNKWIGKAGGNLFGKNDISQT---TQIVAVQGMSYSCVWKNRETALT 186

  Fly   243 NKTLT----REEPFFSESGEVIGKIPMMVQEANFAYVSN--VEGLDGYVLELPYGTQDRLAMIVV 301
            |:|.|    .::||       :....||..||...:.:|  |.|     :.:|:...| :.|:|:
  Fly   187 NRTFTLLRQNKKPF-------VYTTQMMYTEAPMDFFNNDQVRG-----VMVPFKNSD-MGMLVL 238

  Fly   302 LPKRGFKLNDVANNLKALGLRPILQRLAAFRNRASEDNEVEVMMPKFVTATDFTLKGVLIQMGIR 366
            ||:..:....:..:|..: |:..|:|          ..:..:.:|||..:....|...|..:||:
  Fly   239 LPRPRYSTQQILYSLDTI-LKIKLRR----------SKKTHLFLPKFKVSESVDLNMALKALGIQ 292

  Fly   367 DLF-DENTANLDRMSS 381
            :|| :.|.||..:.:|
  Fly   293 NLFTNTNAANFKQYNS 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 65/329 (20%)
Spn75FNP_001036614.1 SERPIN 21..353 CDD:294093 68/341 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446348
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.