DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and Serpinb9d

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001100821.1 Gene:Serpinb9d / 306890 RGDID:1308725 Length:337 Species:Rattus norvegicus


Alignment Length:352 Identity:94/352 - (26%)
Similarity:166/352 - (47%) Gaps:28/352 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 LVLLYEGSEGETRNQLKKSLRINVE-DEKLRGAYKVWSSFLNITTSTIEVATLQAIYTGKGYPIK 172
            :|||  |::|:|..|:.::|.:|.. ||.:...:::....||...|...:.....::......:.
  Rat     1 MVLL--GAKGDTAVQISQALNLNKHPDEDIHKDFQLLLHNLNKPKSHYCLRIANRLFAENTCKLV 63

  Fly   173 NNYRDA-IQNYNVQPMEVDF--YSPDSVIQINEDTNRTTRGLIPYTILPQDVYGA--KMFLLSSL 232
            ..|::: ::.||.:..::.|  .:.:|...||...::.|.|.|| .:|..|..|:  |:.::::|
  Rat    64 PTYKESCLRFYNSEIEQLSFAKAAEESRKHINTWVSKQTEGKIP-ELLSSDSVGSETKLIMVNAL 127

  Fly   233 YFKGQWKFPFNKTLTREEPFFSESGEVIGKIPMMVQEANF--AYVSNVEGLDGYVLELPYGTQDR 295
            ||:|.|...|:|..|.|.||.....|. ..:.||.||..|  |||..::   ..:|.:||...: 
  Rat   128 YFQGSWLHCFDKEFTMEMPFKINKKET-KPVQMMWQEETFDVAYVKEIQ---AQILVMPYRGME- 187

  Fly   296 LAMIVVLPKRGFKLNDVANNLKALGLRPILQRLAAF-RNRASEDNEVEVMMPKFVTATDFTLKGV 359
            ::.:|:||..|..:..|.::|       ..::|.|: :.......||.|.:|||.....:.:..:
  Rat   188 MSFMVLLPDEGVDIRKVESSL-------TFEKLTAWTKPEFIYSTEVYVYLPKFQLQEQYDMTAL 245

  Fly   360 LIQMGIRDLFDENTANLDRM--SSGLFAKLVVHSTKIIVDEQGTTAGAVTEAALANKAT--PPKF 420
            ...:|:.|:|.|..|:|..|  ...|.....||...:.|:|:||.|.|.:.|......:  .|.|
  Rat   246 FQHLGMIDVFSEIKADLSGMCPEKDLCVSKFVHECVVEVNEEGTEAAAASAADCCYSCSEYTPTF 310

  Fly   421 LLNRPFQYMIVEKATGLLLFAGQVRNP 447
            ..:|||.:.|....|..:||.|:..:|
  Rat   311 CADRPFLFFIRHNQTNSILFCGRFSSP 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 93/347 (27%)
Serpinb9dNP_001100821.1 SERPIN 1..337 CDD:294093 93/350 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.