DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and Serpinb3

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001382662.1 Gene:Serpinb3 / 304688 RGDID:1549766 Length:387 Species:Rattus norvegicus


Alignment Length:405 Identity:102/405 - (25%)
Similarity:194/405 - (47%) Gaps:52/405 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 SQGVQDFALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRINV----- 132
            ::....|.|:|.:    ::..:..:...||.|:.:.|.:|..|::|.|..|::|:|:::.     
  Rat     5 AKATTQFTLELYR----QLRDSEDNIFYSPLSIMTALAMLQLGAKGNTEKQIEKALQLSETTKKP 65

  Fly   133 --------EDEKLRGAYKVWSSFLNITTSTIEVATLQAIYTGKGYPIKNNYRDAIQNY---NVQP 186
                    ::|.:...::...:.||.:....::.:..:||..||:|....:.:.|:.|   ||:.
  Rat    66 KEKSADSHDEENVHEQFRKIMNQLNKSNGAYDLKSPNSIYGAKGFPFLQTFMEDIKKYYQANVES 130

  Fly   187 MEVDFYSPDSVIQINEDTNRTTRGLIPYTILPQDVYGAK--MFLLSSLYFKGQWKFPFNKTLTRE 249
            ::....:.:|..:||......|.|.|. .:.|:....:.  :.|::::||||||...|::..|||
  Rat   131 LDFAHAAEESQKKINSWVENKTNGKIK-DLFPRGSLNSSTILVLVNAVYFKGQWNHKFDEQRTRE 194

  Fly   250 EPFFSESGEVIGKIPMMVQ--EANFAYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGFKLNDV 312
            :.|:... .....:.||.|  |.||.::.:|:   ..::|:||..:: |:|.::||         
  Rat   195 DKFWLNK-NTSKPVQMMRQTNEFNFIFLEDVQ---AKMVEIPYKGKE-LSMFILLP--------- 245

  Fly   313 ANNLKALGLRPILQRLAAFRNRA--SEDN----EVEVMMPKFVTATDFTLKGVLIQMGIRDLFDE 371
               ::..||:.:.::|:|....|  |..|    ::.:.:|:|.....:.|.|.|..||:.|.|:.
  Rat   246 ---MEIDGLKKLEEKLSADTLLAWTSPKNMRMTQLNLSLPRFKVQEKYDLPGPLEHMGMVDAFNP 307

  Fly   372 NTANLDRMSS--GLFAKLVVHSTKIIVDEQGTTAGAVT--EAALANKATPPKFLLNRPFQYMIVE 432
            ..|:...|||  ||....|:|.:.:.|:|:|..|.|.|  |..:.:.....:|..||||...|..
  Rat   308 QKADFSGMSSTKGLVVSKVLHKSFLEVNEEGAEAAAATGVETRILSAPRTTEFTCNRPFIVFIKP 372

  Fly   433 KATGLLLFAGQVRNP 447
            ..|..:||.|:|.:|
  Rat   373 NNTNSILFFGRVSSP 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 100/398 (25%)
Serpinb3NP_001382662.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.