DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and LOC299282

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001376144.2 Gene:LOC299282 / 299282 RGDID:3745 Length:413 Species:Rattus norvegicus


Alignment Length:393 Identity:109/393 - (27%)
Similarity:198/393 - (50%) Gaps:36/393 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 VSISQGVQDFALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRIN--- 131
            ::::....||||.|.::::  :...:|:.:.||.|:.:.|.:|..|::..|..::.:.|:.|   
  Rat    43 LTLASSNTDFALSLYKKLA--LRNPDKNVVFSPLSISAALTILSLGAKDSTMEEILEGLKFNLTE 105

  Fly   132 VEDEKLRGAYKVWSSFLNITTSTIEVATLQAIYTGKGYPIKNNYRDAIQN-YNVQPMEVDFYSPD 195
            :.:|::...:......|:.....:|:.|..|::..|..||.:.:::..:. |..:....||..|:
  Rat   106 ITEEEIHQGFGHLLQRLSQPEDQVEINTGSALFIDKEQPILSEFQEKTRALYQAEAFIADFKQPN 170

  Fly   196 SVIQ-INEDTNRTTRGLIP--YTILPQDVYGAKMFLLSSLYFKGQWKFPFNKTLTREEPFFSESG 257
            ...: ||:..:..|:|.|.  ::.|.:   ...|.|::.|.|||:||.|||...|.|..|:.:..
  Rat   171 EAKKLINDYVSNQTQGKIAELFSDLEE---RTSMVLVNYLLFKGKWKVPFNPNDTFESEFYLDEK 232

  Fly   258 EVIGKIPMM-VQEANFAYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGFKLNDVANNLKALGL 321
            ..: |:||| ::|....||.: |.|...||||.|  ....:.:.:||.:| |:..|.::|:...|
  Rat   233 RSV-KVPMMKIKEVTTPYVRD-EELSCSVLELKY--TGNASALFILPDQG-KMQQVESSLQPETL 292

  Fly   322 R----PILQRLAAFRNRASEDNEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANLDRM--S 380
            :    .::.|:..           ::.||||..:||::||.||.::||:.:|.:. |:|.|:  :
  Rat   293 KKWKDSLIPRIIN-----------DLRMPKFSISTDYSLKEVLPELGIKKVFSQQ-ADLSRITGT 345

  Fly   381 SGLFAKLVVHSTKIIVDEQGTTAGAVTEAALANKATPPKFLLNRPFQYMIVEKATGLLLFAGQVR 445
            ..|:...|||...:.|||.||.|.|.|..|...:..|.....||||..:|.:..:..:||..::.
  Rat   346 KDLYVSQVVHKAVLDVDETGTEATAATGVATVIRRQPRTLNFNRPFMVVITDMDSQSILFVAKIT 410

  Fly   446 NPK 448
            |||
  Rat   411 NPK 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 106/382 (28%)
LOC299282NP_001376144.2 serpinA3_A1AC 36..413 CDD:381019 107/391 (27%)
RCL 365..389 7/23 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.