DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and LOC299277

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_008763124.2 Gene:LOC299277 / 299277 RGDID:1595900 Length:420 Species:Rattus norvegicus


Alignment Length:431 Identity:107/431 - (24%)
Similarity:189/431 - (43%) Gaps:47/431 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LTAFTAPTAF--QSG-------VSHIQSMRSNFDTDVLVSISQGVQDFALDLLQRISVEVEKANK 96
            :||...|.|.  :.|       |...|..:...|:..|.||:   .|||..|.:.::  ::..||
  Rat    10 ITAVICPAALCCRDGTLGRHPEVQKDQDTKKQLDSGTLASIN---TDFAFSLYKELA--LKNPNK 69

  Fly    97 DFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRINVEDE---KLRGAYKVWSSFLNITTSTIEVA 158
            :...||.|:.:.|..|..|::|.|..::.:.|:.|:.:.   .:...|:.....|:......:::
  Rat    70 NIAFSPLSISAALASLSLGAKGNTLQEILEGLKFNLTETTEIDIHQNYRDLLQRLSQPGGQGQIS 134

  Fly   159 TLQAIYTGKGYPIKNNYRD-AIQNYNVQPMEVDFYSPDSVIQ-INEDTNRTTRGLIPYTILPQDV 221
            ....::..|...|.|.::: |...|..:....||.......: ||:.....::|.|...:...: 
  Rat   135 RANLLFVEKHLQILNGFKEKAKALYQTEVFATDFQQTCEARKFINDYVMIQSQGKIKEMVTELE- 198

  Fly   222 YGAKMFLLSSLYFKGQWKFPFNKTLTREEPFFSESGEVIGKIPMMVQEANFAYVSNVEGLDGYVL 286
            ....:.:|:.|.|.|||..||:...|....|..:|...:..:.|..::....|..: |.|...|:
  Rat   199 ERTSIVMLNFLLFTGQWSVPFDPDDTFMGKFILDSRRPVKVLMMKTEDLTTPYFWD-EELKCTVV 262

  Fly   287 ELPYGTQDRLAMIVVLPKRGFKLNDVANNLKALGLRPILQRLAAFRNRASEDNEVEVMMPKFVTA 351
            ||.|....: ||. :||.:| |:..|..:|....||.....|   :.|..:    |:.:|||..:
  Rat   263 ELNYKGHGK-AMF-ILPDQG-KMEQVEASLHPGTLRKWTDSL---KPRIID----ELHLPKFSLS 317

  Fly   352 TDFTLKGVLIQMGIRDLFDENT-ANLDRMSSGLFAKL--VVHSTKIIVDEQGTTAGAVTEAALAN 413
            ..:.|:.:|.::||.|:|  || |:|..::.....::  ::|:|.:.:.|.||.|.|.|.  :..
  Rat   318 KTYKLENILPELGIMDVF--NTQADLSGIAGAKDVRVSQMIHNTVLGMAETGTEAEATTR--VEY 378

  Fly   414 KATPPKFLLN-------RPFQYMIVEKATGLLLFAGQVRNP 447
            ...|.|  ||       |.|.||::|..:.|:.|..:|.||
  Rat   379 NFRPAK--LNDTFVNFVRKFLYMVLEPNSELISFMRKVINP 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 93/383 (24%)
LOC299277XP_008763124.2 serpinA3_A1AC 37..417 CDD:381019 98/402 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.