DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and Serpina9

DIOPT Version :9

Sequence 1:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001100224.1 Gene:Serpina9 / 299274 RGDID:1304789 Length:417 Species:Rattus norvegicus


Alignment Length:426 Identity:113/426 - (26%)
Similarity:199/426 - (46%) Gaps:39/426 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LTAFTAP----TAFQSG---VSHIQSMRSNFDTDVLVSISQGVQDFALDLLQRISVEVEKANKDF 98
            :..|.||    .:|.|.   ..|..||:.|..:.|..|.::    ||..|.||::  .:...::.
  Rat    11 VVGFCAPMSCMLSFNSNHRECPHPLSMKRNPASQVTPSNTK----FAFLLYQRLA--QKSPGQNI 69

  Fly    99 MISPFSVWSLLVLLYEGSEGETRNQLKKSLRIN---VEDEKLRGAYKVWSSFLNITTSTIEVATL 160
            :.||.|:.:.|.:|..|:...|:.|:.:||..|   :.:..:...::.....||.....:|:...
  Rat    70 LFSPVSISTSLAMLSLGACSATKTQILRSLGFNITHIAEHTIHLGFEQLVHSLNECHKDLELRMG 134

  Fly   161 QAIYTGKGYPIKNNYRDAIQN-YNVQPMEVDFYSP-DSVIQINEDTNRTTRGLIPYTILPQDVYG 223
            ..::..|...::..:.|.::. |..:....||.:. .:..|||....|.|:|.:...|...|...
  Rat   135 SVLFIRKELQLQVKFLDRVKKLYGTKVFSEDFSNAVTAQAQINSYVERETKGKVVDVIQDLDSQT 199

  Fly   224 AKMFLLSSLYFKGQWKFPFNKTLTREE-PFFSESGEVIGKIPMMVQEANFAYVSNVEGLDGYVLE 287
            | |.|::.::||..|..||:...|.:. ||....|..: .:|||.|..:||:..:.| |...:|:
  Rat   200 A-MVLVNHIFFKANWTQPFSAANTNKSFPFLLSKGTTV-HVPMMHQTESFAFGVDRE-LGCSILQ 261

  Fly   288 LPYGTQDRLAMIVVLPKRGFKLNDVANNLKALGLRPILQRLAAFRNRASEDNEVEVMMPKFVTAT 352
            :.| ..|.:|.. |||.:| |:..:..:|....||.        .:|:.:...::|.:|||..:.
  Rat   262 MDY-RGDAVAFF-VLPGKG-KMRQLERSLSPRRLRR--------WSRSLQKRWIKVFIPKFSISA 315

  Fly   353 DFTLKGVLIQMGIRDLFDENTANLDRMSSGLFAKL--VVHSTKIIVDEQGTTAGAVTEAAL--AN 413
            .:.|:.:|.:|||||.|:.| |:...::...|.::  ..|...:.|.|:||.|.|.|...|  .:
  Rat   316 SYNLETILPEMGIRDAFNSN-ADFSGITKTHFLQVSKAAHKAVLDVSEEGTEAAAATTTKLIVRS 379

  Fly   414 KATPPKFL-LNRPFQYMIVEKATGLLLFAGQVRNPK 448
            :.||...: .|.||..::::|.|..:||.|:|.||:
  Rat   380 RDTPSSTIAFNEPFLILLLDKNTESILFLGKVENPR 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 99/379 (26%)
Serpina9NP_001100224.1 serpin 32..417 CDD:422956 108/405 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.